What is the catalog number for SNCA antibody - middle region (ARP42350_P050)?

The catalog number for SNCA antibody - middle region (ARP42350_P050) is ARP42350_P050.

What sizes are available for SNCA antibody - middle region (ARP42350_P050)?

SNCA antibody - middle region (ARP42350_P050) is available in the following size(s): 100 µL.

Is SNCA antibody - middle region (ARP42350_P050) in stock?

SNCA antibody - middle region (ARP42350_P050) is currently made to order / not held in immediate stock. Contact us for lead time.

Is this kit compatible with automated liquid handling platforms?

Automation compatibility varies by kit and isn’t always listed on the datasheet. Contact our technical support team with details of your platform so we can confirm with the manufacturer.

What applications has this product been validated for?

Validated applications such as WB, ELISA, IHC, ICC, or FC are listed on the product datasheet. If you need application-specific validation data before ordering, contact our technical support team with the catalogue number.

How do I reconstitute this lyophilized product?

Reconstitution instructions, including the recommended diluent and final concentration, are provided on the datasheet. Aliquot immediately after reconstitution to avoid repeated freeze-thaw cycles.

SNCA antibody - middle region (ARP42350_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

Synuclein, alpha (non A4 component of amyloid precursor)

Gene Aliases

PD1, NACP, PARK1, PARK4

Gene ID

6622

Swiss Prot

P37840-2

Accession Number

NP_009292

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SNCA

Target

Alpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Synucleins are abundantly expressed in the brain and alpha- and beta-synuclein inhibit phospholipase D2 selectively. SNCA may serve to integrate presynaptic signaling and membrane trafficking. Defects in SNCA have been implicated in the pathogenesis of Parkinson disease. SNCA peptides are a major component of amyloid plaques in the brains of patients with Alzheimer's disease.Alpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Synucleins are abundantly expressed in the brain and alpha- and beta-synuclein inhibit phospholipase D2 selectively. SNCA may serve to integrate presynaptic signaling and membrane trafficking. Defects in SNCA have been implicated in the pathogenesis of Parkinson disease. SNCA peptides are a major component of amyloid plaques in the brains of patients with Alzheimer's disease. Two alternatively spliced transcripts of SNCA have been identified. Additional splicing may be present but the full-length nature of these variants has not been determined.

Partner Proteins

NEDD4L; UBC; NEDD4; SNCA; GAPDH; HPRT1; CHMP5; KLK6; PARK7; LAMP2; CDC5; SLG1; PLK2; SAC7; TUS1; ROM2; MID2; Csnk2b; Lyn; Fgr; Csnk1g3; Syk; Rab5a; YWHAQ; ARPP19; RABAC1; TUBA1B; CALM; ACTA1; HIST2H3C; TUBB1; BDH2; USP47; SAP30BP; PELP1; SIN3A; Rab3a; ENC

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

VTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKEGYQDYEPEA

Applications

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol