Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGB Antibody - middle region (ARP42217_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

Fibrinogen beta chain

Gene Aliases

HEL-S-78p

Gene ID

2244

Swiss Prot

P02675

Accession Number

NP_001171670.1

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human FGB

Target

The protein encoded by this gene is the beta component of fibrinogen, a blood-borne glycoprotein comprised of three pairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrin which is the most abundant component of blood clots. In addition, various cleavage products of fibrinogen and fibrin regulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for several cell types. Mutations in this gene lead to several disorders, including afibrinogenemia, dysfibrinogenemia, hypodysfibrinogenemia and thrombotic tendency. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

GNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNK

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 91%; Dog: 86%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 93%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

29kDa

Protein Length

272

NCBI Gene Symbol

FGB

Host or Source

Rabbit

Protein Name

Fibrinogen beta chain

Gene Name URL

FGB

Nucleotide Accession Number

NM_001184741.1

More Discoveries

Explore Other Products

Browse additional items from our catalog

HDAC8, NT (Histone Deacetylase 8, HD8, CDA07, HDAC8, HDACL1) (MaxLight 405)
MBS6479580-01 0.1 mL

HDAC8, NT (Histone Deacetylase 8, HD8, CDA07, HDAC8, HDACL1) (MaxLight 405)

Sign In for Pricing
View Details
HDAC8, NT (Histone Deacetylase 8, HD8, CDA07, HDAC8, HDACL1) (MaxLight 405)
MBS6479580-02 5x 0.1 mL

HDAC8, NT (Histone Deacetylase 8, HD8, CDA07, HDAC8, HDACL1) (MaxLight 405)

Sign In for Pricing
View Details
KIR2DS2, ID (KIR2DS2, CD158J, NKAT5, Killer cell immunoglobulin-like receptor 2DS2, CD158 antigen-like family member J, MHC class I NK cell receptor, NK receptor 183 ActI, Natural killer-associated transcript 5, p58 natural killer cell receptor clone CL-49, CD158j) (AP) discontinued
037459-AP 200 µL

KIR2DS2, ID (KIR2DS2, CD158J, NKAT5, Killer cell immunoglobulin-like receptor 2DS2, CD158 antigen-like family member J, MHC class I NK cell receptor, NK receptor 183 ActI, Natural killer-associated transcript 5, p58 natural killer cell receptor clone CL-49, CD158j) (AP) discontinued

Sign In for Pricing
View Details
RPS17 Peptide
DF9118-BP 1 mg

RPS17 Peptide

Sign In for Pricing
View Details
Tas2r126 Mouse shRNA Lentiviral Particle (Locus ID 387353)
TL508697V 500 µL Each

Tas2r126 Mouse shRNA Lentiviral Particle (Locus ID 387353)

Sign In for Pricing
View Details
Recombinant Mouse Disks large homolog 4 (Dlg4)
MBS1473008-01 0.02 mg (E-Coli)

Recombinant Mouse Disks large homolog 4 (Dlg4)

Sign In for Pricing
View Details