Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Btrc Antibody - C-terminal region

Product Specifications

CAS Number

9007-83-4

Gene Name

Beta-transducin repeat containing protein

Gene Aliases

Sl, HOS, FWD1, Fbw1, Fbw1a, Slimb, b-TrCP, beta-T, Beta-Tr, beta-TrCP, Beta-Trcp1, SCF b-TRCP, E3RSIkappaB, E3RS-IkappaB

Gene ID

12234

Swiss Prot

Q3ULA2

Accession Number

NP_001032847

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit

Target

Btrc is a substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. It recognizes and binds to phosphorylated target proteins. SCF (BTRC) mediates the ubiquitination of CTNNB1 and participates in Wnt signaling. SCF (BTRC) mediates the ubiquitination of NFKBIA, NFKBIB and NFKBIE; the degradation frees the associated NFKB1 to translocate into the nucleus and to activate transcription. Ubiquitination of NFKBIA occurs at 'Lys-21' and 'Lys-22'. SCF (BTRC) mediates the ubiquitination of phosphorylated NFKB1/nuclear factor NF-kappa-B p105 subunit, ATF4, SMAD3, SMAD4, CDC25A, DLG1, FBXO5 and probably NFKB2. SCF (BTRC) mediates the ubiquitination of phosphorylated SNAI1.

Partner Proteins

ZRANB1; Tpx2; Taz; Per2; Cul1; Skp1a; Reg1; Stat1; Nfe2l2; Per1; Htt; Cops2; Ikbkb; Nkx3-2; Cdc25b; Nfkbia; Gli2

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

LVEHSGRVFRLQFDEFQIVSSSHDDTILIWDFLNDPAAHAEPPRSPSRTY

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 86%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

69kDa

Protein Length

605

NCBI Gene Symbol

BTRC

Host or Source

Rabbit

Protein Name

F-box/WD repeat-containing protein 1A

Gene Name URL

Btrc

Nucleotide Accession Number

NM_001037758

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Complement C4d (C4D204), CF647 conjugate, 0.1mg/mL
BNC470204-100 1x 100 µL

Complement C4d (C4D204), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF555 conjugate, 0.1mg/mL
BNC550525-500 1x 500 µL

CD63 (MX-49.129.5), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF640R conjugate, 0.1mg/mL
BNC400151-100 1x 100 µL

CD11a (Cris-3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF594 conjugate, 0.1mg/mL
BNC940017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC18 / Mucin 18 / CD146 (OJ79c), CF568 conjugate, 0.1mg/mL
BNC680676-500 1x 500 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (T311 + OCA1/812), CF568 conjugate, 0.1mg/mL
BNC680908-500 1x 500 µL

Tyrosinase (T311 + OCA1/812), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details