Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STC1 antibody - N-terminal region (ARP42104_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

Stanniocalcin 1

Gene Aliases

STC

Gene ID

6781

Swiss Prot

P52823

Accession Number

NP_003146

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human STC1

Target

STC1 is a secreted, homodimeric glycoprotein that is expressed in a wide variety of tissues and may have autocrine or paracrine functions. It contains 11 conserved cysteine residues and is phosphorylated by protein kinase C exclusively on its serine residues. The protein may play a role in the regulation of renal and intestinal calcium and phosphate transport, cell metabolism, or cellular calcium/phosphate homeostasis. Overexpression of human stanniocalcin 1 in mice produces high serum phosphate levels, dwarfism, and increased metabolic rate.This gene encodes a secreted, homodimeric glycoprotein that is expressed in a wide variety of tissues and may have autocrine or paracrine functions. The gene contains a 5' UTR rich in CAG trinucleotide repeats. The encoded protein contains 11 conserved cysteine residues and is phosphorylated by protein kinase C exclusively on its serine residues. The protein may play a role in the regulation of renal and intestinal calcium and phosphate transport, cell metabolism, or cellular calcium/phosphate homeostasis. Overexpression of human stanniocalcin 1 in mice produces high serum phosphate levels, dwarfism, and increased metabolic rate. This gene has altered expression in hepatocellular, ovarian, and breast cancers. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

MLQNSAVLLVLVISASATHEAEQNDSVSPRKSRVAAQNSAEVVRCLNSAL

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

28 kDa

Protein Length

247

NCBI Gene Symbol

STC1

Host or Source

Rabbit

Protein Name

Stanniocalcin-1

Gene Name URL

STC1

Nucleotide Accession Number

NM_003155

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Oryza sativa subsp. japonica Maltose excess protein 1-like, chloroplastic (Os04g0602400, LOC_Os04g51330), partial
MBS7090828 Inquire

Recombinant Oryza sativa subsp. japonica Maltose excess protein 1-like, chloroplastic (Os04g0602400, LOC_Os04g51330), partial

Sign In for Pricing
View Details
Monoclonal Antibody to Neurofilament NF-L (Clone: DA2)
34-1081-500 500 μL

Monoclonal Antibody to Neurofilament NF-L (Clone: DA2)

Sign In for Pricing
View Details
Rabbit Corneodesmosin (CDSN) ELISA Kit
abx363465 96 Well

Rabbit Corneodesmosin (CDSN) ELISA Kit

Sign In for Pricing
View Details
CDX4 (Homeobox Protein CDX-4, Caudal-Type Homeobox Protein 4, CDX4) (MaxLight 490) discontinued
302341-ML490 100 µL

CDX4 (Homeobox Protein CDX-4, Caudal-Type Homeobox Protein 4, CDX4) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Putative glycine--tRNA ligase, cytoplasmic (At1g29870)
MBS1396273-01 0.02 mg (E-Coli)

Recombinant Arabidopsis thaliana Putative glycine--tRNA ligase, cytoplasmic (At1g29870)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Putative glycine--tRNA ligase, cytoplasmic (At1g29870)
MBS1396273-02 0.02 mg (Yeast)

Recombinant Arabidopsis thaliana Putative glycine--tRNA ligase, cytoplasmic (At1g29870)

Sign In for Pricing
View Details