What is the catalog number for GH2 antibody - middle region (ARP42013_T100)?

The catalog number for GH2 antibody - middle region (ARP42013_T100) is ARP42013_T100.

What sizes are available for GH2 antibody - middle region (ARP42013_T100)?

GH2 antibody - middle region (ARP42013_T100) is available in the following size(s): 100 µL.

Is GH2 antibody - middle region (ARP42013_T100) in stock?

GH2 antibody - middle region (ARP42013_T100) is currently made to order / not held in immediate stock. Contact us for lead time.

What should I do if I need to report a performance issue with a specific lot of this product?

Provide the catalogue number, product name, lot number, and your experimental results to our technical support team. They’ll investigate and, if needed, escalate to the manufacturer, provided the product was used before expiry and stored correctly.

What is the isotype of this antibody?

Isotype information such as IgG1 or IgG2a is listed in the product specifications on the datasheet, relevant for selecting compatible detection reagents.

Can I get a trial-size or discounted first order of this product?

We don’t generally offer free samples, but trial discounts in exchange for feedback and validation results are almost always possible. Contact us with your intended application to arrange one.

GH2 antibody - middle region (ARP42013_T100)

Product Specifications

CAS Number

9007-83-4

Gene Name

Growth hormone 2

Gene Aliases

GHL, GHV, GH-V, GHB2, hGH-V

Gene ID

2689

Swiss Prot

O14643

Accession Number

NP_072050

Reactivity

Human, Mouse, Rat, Cow, Goat, Horse, Pig, Rabbit, Sheep

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human GH2

Target

GH2 is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. Mutations in its gene lead to placental growth hormone/lactogen deficiency.The protein encoded by this gene is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. The gene, along with four other related genes, is located at the growth hormone locus on chromosome 17 where they are interspersed in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. The five genes share a remarkably high degree of sequence identity. Alternative splicing generates additional isoforms of each of the five growth hormones, leading to further diversity and potential for specialization. As in the case of its pituitary counterpart, growth hormone 1, the predominant isoform of this particular family member shows similar somatogenic activity, with reduced lactogenic activity. Mutations in this gene lead to placental growth hormone/lactogen deficiency.

Partner Proteins

GHR

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

NQSYSKFDTKSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSC

Applications

Purification

Protein A purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol