Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

F13B Antibody - middle region

Product Specifications

Gene Name

Coagulation factor XIII, B polypeptide

Gene Aliases

FXIIIB

Gene ID

2165

Swiss Prot

P05160

Accession Number

NP_001985

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human F13B

Target

F13B contains 10 Sushi (CCP/SCR) domains. The B chain of factor XIII is not catalytically active, but is thought to stabilize the A subunits and regulate the rate of transglutaminase formation by thrombin. Defects in F13B can result in a lifelong bleeding tendency, defective wound healing, and habitual abortion.This gene encodes coagulation factor XIII B subunit. Coagulation factor XIII is the last zymogen to become activated in the blood coagulation cascade. Plasma factor XIII is a heterotetramer composed of 2 A subunits and 2 B subunits. The A subunits have catalytic function, and the B subunits do not have enzymatic activity and may serve as a plasma carrier molecules. Platelet factor XIII is comprised only of 2 A subunits, which are identical to those of plasma origin. Upon activation by the cleavage of the activation peptide by thrombin and in the presence of calcium ion, the plasma factor XIII dissociates its B subunits and yields the same active enzyme, factor XIIIa, as platelet factor XIII. This enzyme acts as a transglutaminase to catalyze the formation of gamma-glutamyl-epsilon-lysine crosslinking between fibrin molecules, thus stabilizing the fibrin clot. Factor XIII deficiency is classified into two categories: type I deficiency, characterized by the lack of both the A and B subunits; and type II deficiency, characterized by the lack of the A subunit alone. These defects can result in a lifelong bleeding tendency, defective wound healing, and habitual abortion. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Partner Proteins

FGG; F13A1

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

LRLIENGYFHPVKQTYEEGDVVQFFCHENYYLSGSDLIQCYNFGWYPESP

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 100%; Dog: 86%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

73kDa

Protein Length

661

NCBI Gene Symbol

F13B

Host or Source

Rabbit

Protein Name

Coagulation factor XIII B chain

Gene Name URL

F13B

CAS Number

9007-83-4

Nucleotide Accession Number

NM_001994

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

pLV3-CMV-FOLH1-3×FLAG-Fluc-Puro Plasmid
PVT49713 2 µg

pLV3-CMV-FOLH1-3×FLAG-Fluc-Puro Plasmid

Ask
View Details
Odontogenic ameloblast-associated protein (ODAM) Monkey ELISA Kit
F5289 96 Tests

Odontogenic ameloblast-associated protein (ODAM) Monkey ELISA Kit

Ask
View Details
Rat Proteolipid Protein 2, Colonic Epithelium Enriched ELISA Kit
MBS052296-01 48 Well

Rat Proteolipid Protein 2, Colonic Epithelium Enriched ELISA Kit

Ask
View Details
Rat Proteolipid Protein 2, Colonic Epithelium Enriched ELISA Kit
MBS052296-02 96 Well

Rat Proteolipid Protein 2, Colonic Epithelium Enriched ELISA Kit

Ask
View Details
Rat Proteolipid Protein 2, Colonic Epithelium Enriched ELISA Kit
MBS052296-03 5x 96 Well

Rat Proteolipid Protein 2, Colonic Epithelium Enriched ELISA Kit

Ask
View Details
Rat Proteolipid Protein 2, Colonic Epithelium Enriched ELISA Kit
MBS052296-04 10x 96 Well

Rat Proteolipid Protein 2, Colonic Epithelium Enriched ELISA Kit

Ask
View Details