What is the catalog number for CRABP2 Antibody - middle region?

The catalog number for CRABP2 Antibody - middle region is ARP41983_P050-25UL.

What sizes are available for CRABP2 Antibody - middle region?

CRABP2 Antibody - middle region is available in the following size(s): 25 µL.

Is CRABP2 Antibody - middle region in stock?

CRABP2 Antibody - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product classed as hazardous or restricted for shipping?

Some products are subject to special import/export regulations, dangerous goods handling, or licensing requirements. Where this applies, it’s noted on the product page, and any required extra documents or fees will be confirmed with you before dispatch, never added without your consent.

Can you help me confirm if this product is right for my specific experiment?

Yes, contact us with details of your sample type, species, and intended application, and our specialists will confirm suitability or suggest an alternative from our supplier network if this isn’t the best fit.

What is the purity of this recombinant protein?

Purity, typically assessed by SDS-PAGE, is listed on the datasheet under quality control data.

CRABP2 Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

Cellular retinoic acid binding protein 2

Gene Aliases

RBP6, CRABP-II

Gene ID

1382

Swiss Prot

P29373

Accession Number

NP_001869

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CRABP2

Target

A number of specific carrier proteins for members of the vitamin A family have been discovered. Cellular retinoic acid binding proteins (CRABP) are low molecular weight proteins whose precise function remains unknown. The inducibility of the CRABP2 gene suggests that this isoform is important in retinoic acid-mediated regulation of human skin growth and differentiation. It has been postulated that the CRABP2 gene is transcriptionally regulated by a newly synthesized regulatory protein.A number of specific carrier proteins for members of the vitamin A family have been discovered. Cellular retinoic acid binding proteins (CRABP) are low molecular weight proteins whose precise function remains unknown. The inducibility of the CRABP2 gene suggests that this isoform is important in retinoic acid-mediated regulation of human skin growth and differentiation. It has been postulated that the CRABP2 gene is transcriptionally regulated by a newly synthesized regulatory protein. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Partner Proteins

CCDC155; UBC; UBE2I; SUMO2; SUMO3; CDK2; CRABP2; CCND3

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

FEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELI

Applications

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol