What is the catalog number for RHOBTB1 antibody - middle region (ARP41883_P050)?

The catalog number for RHOBTB1 antibody - middle region (ARP41883_P050) is ARP41883_P050.

What sizes are available for RHOBTB1 antibody - middle region (ARP41883_P050)?

RHOBTB1 antibody - middle region (ARP41883_P050) is available in the following size(s): 100 µL.

Is RHOBTB1 antibody - middle region (ARP41883_P050) in stock?

RHOBTB1 antibody - middle region (ARP41883_P050) is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product suitable for live cell imaging?

Suitability for live cell imaging depends on the specific reagent and conjugate used. Check the datasheet for imaging-specific validation, or contact us for guidance.

Is this product covered by a money-back guarantee?

Yes, we guarantee a full refund or store credit if this product arrives damaged beyond usability, or has a genuine performance issue under proper usage and storage, provided you report it immediately with evidence. Claims after the expiration date or due to improper storage after receipt are excluded.

Can this product be used for diagnostic or therapeutic purposes?

No. This product, like all items we supply, is intended for research laboratory use only and must not be used for diagnostics, therapeutics, treatment, or consumption by humans or animals.

RHOBTB1 antibody - middle region (ARP41883_P050)

Selected Variant

ARP41883_P050

Size: 100 µL

Product Specifications

CAS Number

9007-83-4

Gene Name

Rho-related BTB domain containing 1

Gene Aliases

KIAA0740, MGC33059, MGC33841

Gene ID

9886

Swiss Prot

O94844

Accession Number

NP_055651

Reactivity

Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RHOBTB1

Target

RHOBTB1 belongs to the Rho family of the small GTPase superfamily. It contains a GTPase domain, a proline-rich region, a tandem of 2 BTB (broad complex, tramtrack, and bric-a-brac) domains, and a conserved C-terminal region. The protein plays a role in small GTPase-mediated signal transduction and the organization of the actin filament system.The protein encoded by this gene belongs to the Rho family of the small GTPase superfamily. It contains a GTPase domain, a proline-rich region, a tandem of 2 BTB (broad complex, tramtrack, and bric-a-brac) domains, and a conserved C-terminal region. The protein plays a role in small GTPase-mediated signal transduction and the organization of the actin filament system. Alternate transcriptional splice variants have been characterized.

Partner Proteins

HSP90AA1; CUL3; COPS5; COPS6; CUL5; Lrrc41; UBC

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

DNQEYFERHRWPPVWYLKEEDHYQRVKREREKEDIALNKHRSRRKWCFWN

Applications

IHC, WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 79%; Zebrafish: 93%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

77kDa

Protein Length

696

NCBI Gene Symbol

RHOBTB1

Host or Source

Rabbit

Protein Name

Rho-related BTB domain-containing protein 1

Gene Name URL

RHOBTB1

Nucleotide Accession Number

NM_014836

Price

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

iFluor™ 488 Conjugated FOXO1A Recombinant Rabbit Monoclonal Antibody [SU33-01]

HA720161F 100 µL