Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR5T2 antibody - C-terminal region (ARP41848_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.//here

Product Specifications

CAS Number

9007-83-4

Gene Name

Olfactory receptor, family 5, subfamily T, member 2

Gene Aliases

OR11-177

Gene ID

219464

Swiss Prot

Q6IFC8

Accession Number

NP_001004746

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human OR5T2

Target

Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

DMIVSIFYTIVIPLLNPVIYSLRNKDVKDSMKKMFGKNQVINKVYFHTKK

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Human: 100%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

39kDa

Protein Length

359

NCBI Gene Symbol

OR5T2

Host or Source

Rabbit

Protein Name

Olfactory receptor 5T2

Gene Name URL

OR5T2

Nucleotide Accession Number

NM_001004746

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal SIL1 Antibody (OTI3E3) [Alexa Fluor 488]
NBP2-74193AF488 0.1 mL

Mouse Monoclonal SIL1 Antibody (OTI3E3) [Alexa Fluor 488]

Sign In for Pricing
View Details
Recombinant Human RAB6B
P6783-01 50 µg

Recombinant Human RAB6B

Sign In for Pricing
View Details
Recombinant Human RAB6B
P6783-02 200 µg

Recombinant Human RAB6B

Sign In for Pricing
View Details
Recombinant Human RAB6B
P6783-03 1 mg

Recombinant Human RAB6B

Sign In for Pricing
View Details
DEPDC5 (NM_001007188) Human Tagged Lenti ORF Clone
RC211462L3 10 µg

DEPDC5 (NM_001007188) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Osgin2 Mouse shRNA Lentiviral Particle (Locus ID 209212)
TL506267V 500 µL Each

Osgin2 Mouse shRNA Lentiviral Particle (Locus ID 209212)

Sign In for Pricing
View Details