Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C4B Antibody - N-terminal region

Product Specifications

CAS Number

9007-83-4

Gene Name

Complement component 4B, telomeric

Gene Aliases

C4A, C4F, CO4, C4B1, C4B2, C4B3, C4B5, C4A91, C4B12

Gene ID

432395

Swiss Prot

Q6U2E9

Accession Number

NP_001002029

Reactivity

Human, Mouse, Rat, Dog, Guinea Pig, Horse, Pig

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human C4B

Target

C4B is the basic form of complement factor 4, part of the classical activation pathway. The protein is expressed as a single chain precursor which is proteolytically cleaved into a trimer of alpha, beta, and gamma chains prior to secretion. The trimer provides a surface for interaction between the antigen-antibody complex and other complement components. The alpha chain may be cleaved to release C4 anaphylatoxin, a mediator of local inflammation. Deficiency of this protein is associated with systemic lupus erythematosus. This gene encodes the basic form of complement factor 4, part of the classical activation pathway. The protein is expressed as a single chain precursor which is proteolytically cleaved into a trimer of alpha, beta, and gamma chains prior to secretion. The trimer provides a surface for interaction between the antigen-antibody complex and other complement components. The alpha chain may be cleaved to release C4 anaphylatoxin, a mediator of local inflammation. Deficiency of this protein is associated with systemic lupus erythematosus. This gene localizes to the major histocompatibility complex (MHC) class III region on chromosome 6. Varying haplotypes of this gene cluster exist, such that individuals may have 1, 2, or 3 copies of this gene. In addition, this gene exists as a long form and a short form due to the presence or absence of a 6.4 kb endogenous HERV-K retrovirus in intron 9. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

QTDQPIYNPGQRVRYRVFALDQKMRPSTDTITVMVENSHGLRVRKKEVYM

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Dog: 92%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 79%; Pig: 93%; Rat: 93%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

193kDa

Protein Length

1744

NCBI Gene Symbol

C4B

Host or Source

Rabbit

Protein Name

C4B1 EMBL AAR89163.1

Gene Name URL

C4B

Nucleotide Accession Number

NM_001002029

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

RPL21P98 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
41106061 1.0 µg DNA

RPL21P98 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Ask
View Details
Recombinant Bacillus subtilis Arginine utilization regulatory protein RocR (rocR)
MBS1017488-01 0.02 mg (E-Coli)

Recombinant Bacillus subtilis Arginine utilization regulatory protein RocR (rocR)

Ask
View Details
Recombinant Bacillus subtilis Arginine utilization regulatory protein RocR (rocR)
MBS1017488-02 0.02 mg (Yeast)

Recombinant Bacillus subtilis Arginine utilization regulatory protein RocR (rocR)

Ask
View Details
Recombinant Bacillus subtilis Arginine utilization regulatory protein RocR (rocR)
MBS1017488-03 0.1 mg (E-Coli)

Recombinant Bacillus subtilis Arginine utilization regulatory protein RocR (rocR)

Ask
View Details
Recombinant Bacillus subtilis Arginine utilization regulatory protein RocR (rocR)
MBS1017488-04 0.1 mg (Yeast)

Recombinant Bacillus subtilis Arginine utilization regulatory protein RocR (rocR)

Ask
View Details
Recombinant Bacillus subtilis Arginine utilization regulatory protein RocR (rocR)
MBS1017488-05 0.02 mg (Baculovirus)

Recombinant Bacillus subtilis Arginine utilization regulatory protein RocR (rocR)

Ask
View Details