Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UGT1A6 antibody - C-terminal region (ARP41458_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

UDP glucuronosyltransferase 1 family, polypeptide A6

Gene Aliases

GNT1, UGT1, HLUGP, UDPGT, UGT1A, UGT1C, UGT1E, UGT1F, HLUGP1, UGT-1A, UGT-1C, UGT-1E, UGT-1F, UGT1.1, UGT1.3, UGT1.5, UGT1.6, UGT1A1, UGT1A3, UGT1A5, UGT1-01, UGT1-03, UGT1-05, UGT1-06, UGT1A6S, hUG-BR1, UDPGT 1-6

Gene ID

54578

Swiss Prot

P19224

Accession Number

NP_001063

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human UGT1A6

Target

UGT1A6 is a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases. The locus includes thirteen unique alternate first exons followed by four common exons. Four of the alternate first exons are considered pseudogenes. Each of the remaining nine 5' exons may be spliced to the four common exons, resulting in nine proteins with different N-termini and identical C-termini. Each first exon encodes the substrate binding site, and is regulated by its own promoter. The enzyme is active on phenolic and planar compounds. Alternative splicing in the unique 5' end of this gene results in two transcript variants.This gene encodes a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases. The locus includes thirteen unique alternate first exons followed by four common exons. Four of the alternate first exons are considered pseudogenes. Each of the remaining nine 5' exons may be spliced to the four common exons, resulting in nine proteins with different N-termini and identical C-termini. Each first exon encodes the substrate binding site, and is regulated by its own promoter. The enzyme encoded by this gene is active on phenolic and planar compounds. Alternative splicing in the unique 5' end of this gene results in two transcript variants.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

APHLRPAAHDLTWYQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGK

Applications

WB, IHC

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 93%; Zebrafish: 92%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

58kDa

Protein Length

532

NCBI Gene Symbol

UGT1A6

Host or Source

Rabbit

Protein Name

UDP-glucuronosyltransferase 1-6

Gene Name URL

UGT1A6

Nucleotide Accession Number

NM_001072

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIML1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
47851111 3x 1.0 µg

TRIML1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Nori® Donkey BMP2 ELISA Kit
GR170034 96 Well

Nori® Donkey BMP2 ELISA Kit

Sign In for Pricing
View Details
Cytochrome c Oxidase assembly protein COX16 homolog mitochondrial (COX16) Bovine ELISA Kit
C7518 96 Tests

Cytochrome c Oxidase assembly protein COX16 homolog mitochondrial (COX16) Bovine ELISA Kit

Sign In for Pricing
View Details
Human Natural Cytotoxicity Triggering Receptor 2 (NCR2) Antibody Pair Kit (with Standard)
MBS2100900-01 5x 96 Tests

Human Natural Cytotoxicity Triggering Receptor 2 (NCR2) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Human Natural Cytotoxicity Triggering Receptor 2 (NCR2) Antibody Pair Kit (with Standard)
MBS2100900-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Human Natural Cytotoxicity Triggering Receptor 2 (NCR2) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Human Natural Cytotoxicity Triggering Receptor 2 (NCR2) Antibody Pair Kit (with Standard)
MBS2100900-03 10x 96 Tests

Human Natural Cytotoxicity Triggering Receptor 2 (NCR2) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details