Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CA4 antibody - middle region (ARP41421_T100)

Product Specifications

CAS Number

9007-83-4

Gene Name

Carbonic anhydrase IV

Gene Aliases

CAIV, Car4, RP17

Gene ID

762

Swiss Prot

P22748

Accession Number

NP_000708

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CA4

Target

Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA IV is a glycosylphosphatidyl-inositol-anchored membrane isozyme expressed on the luminal surfaces of pulmonary (and certain other) capillaries and of proximal renal tubules. Its exact function is not known, however, it may have a role in inherited renal abnormalities of bicarbonate transport.Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA IV is a glycosylphosphatidyl-inositol-anchored membrane isozyme expressed on the luminal surfaces of pulmonary (and certain other) capillaries and of proximal renal tubules. Its exact function is not known, however, it may have a role in inherited renal abnormalities of bicarbonate transport.

Partner Proteins

PIH1D1; PRDX2; Htt; SLC4A4; SLC4A1; SLC4A3

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

DGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGF

Applications

WB

Purification

Protein A purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

1.0 mg/ml

Homology

Human: 100%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

34kDa

Protein Length

312

NCBI Gene Symbol

CA4

Host or Source

Rabbit

Protein Name

Carbonic anhydrase 4

Gene Name URL

CA4

Nucleotide Accession Number

NM_000717

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Ralstonia metallidurans Gamma-glutamyl phosphate reductase (proA)
MBS1417578-01 0.02 mg (E-Coli)

Recombinant Ralstonia metallidurans Gamma-glutamyl phosphate reductase (proA)

Sign In for Pricing
View Details
Recombinant Ralstonia metallidurans Gamma-glutamyl phosphate reductase (proA)
MBS1417578-02 0.02 mg (Yeast)

Recombinant Ralstonia metallidurans Gamma-glutamyl phosphate reductase (proA)

Sign In for Pricing
View Details
Recombinant Ralstonia metallidurans Gamma-glutamyl phosphate reductase (proA)
MBS1417578-03 0.1 mg (E-Coli)

Recombinant Ralstonia metallidurans Gamma-glutamyl phosphate reductase (proA)

Sign In for Pricing
View Details
Recombinant Ralstonia metallidurans Gamma-glutamyl phosphate reductase (proA)
MBS1417578-04 0.1 mg (Yeast)

Recombinant Ralstonia metallidurans Gamma-glutamyl phosphate reductase (proA)

Sign In for Pricing
View Details
Recombinant Ralstonia metallidurans Gamma-glutamyl phosphate reductase (proA)
MBS1417578-05 0.02 mg (Baculovirus)

Recombinant Ralstonia metallidurans Gamma-glutamyl phosphate reductase (proA)

Sign In for Pricing
View Details
Recombinant Ralstonia metallidurans Gamma-glutamyl phosphate reductase (proA)
MBS1417578-06 0.02 mg (Mammalian-Cell)

Recombinant Ralstonia metallidurans Gamma-glutamyl phosphate reductase (proA)

Sign In for Pricing
View Details