Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYP1A1 Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

Cytochrome P450, family 1, subfamily A, polypeptide 1

Gene Aliases

AHH, AHRR, CP11, CYP1, CYPIA1, P1-450, P450-C, P450DX

Gene ID

1543

Swiss Prot

P04798

Accession Number

NP_000490

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CYP1A1

Target

CYP1A1 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by some polycyclic aromatic hydrocarbons (PAHs), some of which are found in cigarette smoke. The enzyme's endogenous substrate is unknown; however, it is able to metabolize some PAHs to carcinogenic intermediates. CYP1A1 has been associated with lung cancer risk. This gene, CYP1A1, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by some polycyclic aromatic hydrocarbons (PAHs), some of which are found in cigarette smoke. The enzyme's endogenous substrate is unknown; however, it is able to metabolize some PAHs to carcinogenic intermediates. The gene has been associated with lung cancer risk. A related family member, CYP1A2, is located approximately 25 kb away from CYP1A1 on chromosome 15. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Partner Proteins

CMTM5; CYB5A

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

FKDLNEKFYSFMQKMVKEHYKTFEKGHIRDITDSLIEHCQEKQLDENANV

Applications

IHC, WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 100%; Dog: 86%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 77%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

58 kDa

Protein Length

512

NCBI Gene Symbol

CYP1A1

Host or Source

Rabbit

Protein Name

Cytochrome P450 1A1

Gene Name URL

CYP1A1

Nucleotide Accession Number

NM_000499

More Discoveries

Explore Other Products

Browse additional items from our catalog

Easypro Mouse Tank Binding Kinase 1 (TBK1) ELISA Kit
FY-EM3361S 96 Well

Easypro Mouse Tank Binding Kinase 1 (TBK1) ELISA Kit

Sign In for Pricing
View Details
DNA repair and recombination protein RAD54-Like (RAD54L) Mouse ELISA Kit
C9418 96 Tests

DNA repair and recombination protein RAD54-Like (RAD54L) Mouse ELISA Kit

Sign In for Pricing
View Details
Monoclonal Antibody to Hypoxia Inducible Factor 1 Alpha (HIF1a)
MBS2151829-01 0.1 mL

Monoclonal Antibody to Hypoxia Inducible Factor 1 Alpha (HIF1a)

Sign In for Pricing
View Details
Monoclonal Antibody to Hypoxia Inducible Factor 1 Alpha (HIF1a)
MBS2151829-02 0.2 mL

Monoclonal Antibody to Hypoxia Inducible Factor 1 Alpha (HIF1a)

Sign In for Pricing
View Details
Monoclonal Antibody to Hypoxia Inducible Factor 1 Alpha (HIF1a)
MBS2151829-03 0.5 mL

Monoclonal Antibody to Hypoxia Inducible Factor 1 Alpha (HIF1a)

Sign In for Pricing
View Details
Monoclonal Antibody to Hypoxia Inducible Factor 1 Alpha (HIF1a)
MBS2151829-04 1 mL

Monoclonal Antibody to Hypoxia Inducible Factor 1 Alpha (HIF1a)

Sign In for Pricing
View Details