Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PIGZ antibody - N-terminal region (ARP41020_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

Phosphatidylinositol glycan anchor biosynthesis, class Z

Gene Aliases

SMP3, PIG-Z, GPI-MT-IV

Gene ID

80235

Swiss Prot

Q86VD9

Accession Number

NP_079439

Reactivity

Human, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit, Yeast

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PIGZ

Target

The glycosylphosphatidylinositol (GPI) anchor is a glycolipid found on many blood cells that serves to anchor proteins to the cell surface. PIGZ is a protein that is localized to the endoplasmic reticulum, and is involved in GPI anchor biosynthesis. As shown for the yeast homolog, which is a member of a family of dolichol-phosphate-mannose (Dol-P-Man) -dependent mannosyltransferases, this protein can also add a side-branching fourth mannose to GPI precursors during the assembly of GPI anchors.The glycosylphosphatidylinositol (GPI) anchor is a glycolipid found on many blood cells that serves to anchor proteins to the cell surface. This gene encodes a protein that is localized to the endoplasmic reticulum, and is involved in GPI anchor biosynthesis. As shown for the yeast homolog, which is a member of a family of dolichol-phosphate-mannose (Dol-P-Man) -dependent mannosyltransferases, this protein can also add a side-branching fourth mannose to GPI precursors during the assembly of GPI anchors.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

VLWGGLSLLRVLWCLLPQTGYVHPDEFFQSPEVMAEDILGVQAARPWEFY

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Yeast: 80%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

63kDa

Protein Length

579

NCBI Gene Symbol

PIGZ

Host or Source

Rabbit

Protein Name

GPI mannosyltransferase 4

Gene Name URL

PIGZ

Nucleotide Accession Number

NM_025163

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Dictyostelium discoideum Probable DNA repair protein RAD51 homolog 4 (rad51d)
MBS1328766-01 0.02 mg (E-Coli)

Recombinant Dictyostelium discoideum Probable DNA repair protein RAD51 homolog 4 (rad51d)

Sign In for Pricing
View Details
Recombinant Dictyostelium discoideum Probable DNA repair protein RAD51 homolog 4 (rad51d)
MBS1328766-02 0.02 mg (Yeast)

Recombinant Dictyostelium discoideum Probable DNA repair protein RAD51 homolog 4 (rad51d)

Sign In for Pricing
View Details
Recombinant Dictyostelium discoideum Probable DNA repair protein RAD51 homolog 4 (rad51d)
MBS1328766-03 0.1 mg (E-Coli)

Recombinant Dictyostelium discoideum Probable DNA repair protein RAD51 homolog 4 (rad51d)

Sign In for Pricing
View Details
Recombinant Dictyostelium discoideum Probable DNA repair protein RAD51 homolog 4 (rad51d)
MBS1328766-04 0.1 mg (Yeast)

Recombinant Dictyostelium discoideum Probable DNA repair protein RAD51 homolog 4 (rad51d)

Sign In for Pricing
View Details
Recombinant Dictyostelium discoideum Probable DNA repair protein RAD51 homolog 4 (rad51d)
MBS1328766-05 0.02 mg (Baculovirus)

Recombinant Dictyostelium discoideum Probable DNA repair protein RAD51 homolog 4 (rad51d)

Sign In for Pricing
View Details
Recombinant Dictyostelium discoideum Probable DNA repair protein RAD51 homolog 4 (rad51d)
MBS1328766-06 0.02 mg (Mammalian-Cell)

Recombinant Dictyostelium discoideum Probable DNA repair protein RAD51 homolog 4 (rad51d)

Sign In for Pricing
View Details