Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPL24 antibody - N-terminal region (ARP41010_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

Mitochondrial ribosomal protein L24

Gene Aliases

L24mt, MRP-L18, MRP-L24

Gene ID

79590

Swiss Prot

Q96A35

Accession Number

NP_078816

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MRPL24

Target

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. MRPL24 is a 39S subunit protein which is more than twice the size of its E.coli counterpart (EcoL24) .Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein which is more than twice the size of its E.coli counterpart (EcoL24) . Sequence analysis identified two transcript variants that encode the same protein.

Partner Proteins

TP53; AURKA; GRSF1; NPM1; MRPL21; C19orf70; MRPL45; TMEM177; MRPL44; MRPL40; MRPS5; TSR1; MRPL39; MRPL51; MRPL37; MRPL4; MRPL2; MRPL13; ERLEC1; MRPL19; TUFM; RPS15; ILF2; ABCC2; APP; CUL3; UBC; Ybx1; ICT1

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

RRRPVVVEPISDEDWYLFCGDTVEILEGKDAGKQGKVVQVIRQRNWVVVG

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

25kDa

Protein Length

216

NCBI Gene Symbol

MRPL24

Host or Source

Rabbit

Protein Name

39S ribosomal protein L24, mitochondrial

Gene Name URL

MRPL24

Nucleotide Accession Number

NM_024540

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Printed with Looped cap Screw Cap Tube, Self-Standing, PP, 0.5 mL, with EPDM ring Cap, Yellow, DNase/RNase free - 1000 un. - ABDO
P10350Y 1000 Units/Pack

Printed with Looped cap Screw Cap Tube, Self-Standing, PP, 0.5 mL, with EPDM ring Cap, Yellow, DNase/RNase free - 1000 un. - ABDO

Ask
View Details
Trimethyl phosphate (Standard)
HY-A0108AR-01 50 mg

Trimethyl phosphate (Standard)

Ask
View Details
Trimethyl phosphate (Standard)
HY-A0108AR-02 100 mg

Trimethyl phosphate (Standard)

Ask
View Details
Trimethyl phosphate (Standard)
HY-A0108AR-03 250 mg

Trimethyl phosphate (Standard)

Ask
View Details
Trimethyl phosphate (Standard)
HY-A0108AR-04 500 mg

Trimethyl phosphate (Standard)

Ask
View Details
Mouse Monoclonal SLC5A5/Sodium Iodide Symporter Antibody (902320) [DyLight 755]
FAB8367Z 0.1 mL

Mouse Monoclonal SLC5A5/Sodium Iodide Symporter Antibody (902320) [DyLight 755]

Ask
View Details