Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PCBP4 antibody - middle region (ARP40943_T100)

Product Specifications

CAS Number

9007-83-4

Gene Name

Poly (rC) binding protein 4

Gene Aliases

CBP, LIP4, MCG10

Gene ID

57060

Swiss Prot

Q9HCU2

Accession Number

NP_127502

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PCBP4

Target

PCBP4 is a member of the KH-domain protein subfamily. Proteins of this subfamily, also referred to as alpha-CPs, bind to RNA with a specificity for C-rich pyrimidine regions. Alpha-CPs play important roles in post-transcriptional activities and have different cellular distributions. This gene is induced by the p53 tumor suppressor, and the protein can suppress cell proliferation by inducing apoptosis and cell cycle arrest in G (2) -M.This gene encodes a member of the KH-domain protein subfamily. Proteins of this subfamily, also referred to as alpha-CPs, bind to RNA with a specificity for C-rich pyrimidine regions. Alpha-CPs play important roles in post-transcriptional activities and have different cellular distributions. This gene is induced by the p53 tumor suppressor, and the encoded protein can suppress cell proliferation by inducing apoptosis and cell cycle arrest in G (2) -M. This gene's protein is found in the cytoplasm, yet it lacks the nuclear localization signals found in other subfamily members. Multiple alternatively spliced transcript variants have been described, but the full-length nature for only some has been determined.This gene encodes a member of the KH-domain protein subfamily. Proteins of this subfamily, also referred to as alpha-CPs, bind to RNA with a specificity for C-rich pyrimidine regions. Alpha-CPs play important roles in post-transcriptional activities and have different cellular distributions. This gene is induced by the p53 tumor suppressor, and the encoded protein can suppress cell proliferation by inducing apoptosis and cell cycle arrest in G (2) -M. This gene's protein is found in the cytoplasm, yet it lacks the nuclear localization signals found in other subfamily members. Multiple alternatively spliced transcript variants have been described, but the full-length nature for only some has been determined.

Partner Proteins

UBD; UBC; RBFOX1; RNF138; QKI; PCBP1; LYST

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

SVQGQYGAVTPAEVTKLQQLSSHAVPFATPSVVPGLDPGTQTSSQEFLVP

Applications

WB

Purification

Protein A purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

1.0 mg/ml

Homology

Cow: 93%; Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 100%; Rat: 93%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

41kDa

Protein Length

369

NCBI Gene Symbol

PCBP4

Host or Source

Rabbit

Protein Name

Poly (RC) binding protein 4, isoform CRA_d EMBL EAW65171.1

Gene Name URL

PCBP4

Nucleotide Accession Number

NM_033009

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human RNA polymerase II transcription factor SIII subunit A3-like-2, TCEB3CL2 ELISA Kit
MBS9322552-01 48 Well

Human RNA polymerase II transcription factor SIII subunit A3-like-2, TCEB3CL2 ELISA Kit

Sign In for Pricing
View Details
Human RNA polymerase II transcription factor SIII subunit A3-like-2, TCEB3CL2 ELISA Kit
MBS9322552-02 96 Well

Human RNA polymerase II transcription factor SIII subunit A3-like-2, TCEB3CL2 ELISA Kit

Sign In for Pricing
View Details
Human RNA polymerase II transcription factor SIII subunit A3-like-2, TCEB3CL2 ELISA Kit
MBS9322552-03 5x 96 Well

Human RNA polymerase II transcription factor SIII subunit A3-like-2, TCEB3CL2 ELISA Kit

Sign In for Pricing
View Details
Human RNA polymerase II transcription factor SIII subunit A3-like-2, TCEB3CL2 ELISA Kit
MBS9322552-04 10x 96 Well

Human RNA polymerase II transcription factor SIII subunit A3-like-2, TCEB3CL2 ELISA Kit

Sign In for Pricing
View Details
Phospho-eNOS (Ser117) Rabbit pAb
E47R13072 100 µL

Phospho-eNOS (Ser117) Rabbit pAb

Sign In for Pricing
View Details
ALDH1A3, ID (ALDH1A3, ALDH6, Aldehyde dehydrogenase family 1 member A3, Aldehyde dehydrogenase 6, Retinaldehyde dehydrogenase 3) (MaxLight 750) discontinued
031768-ML750 100 µL

ALDH1A3, ID (ALDH1A3, ALDH6, Aldehyde dehydrogenase family 1 member A3, Aldehyde dehydrogenase 6, Retinaldehyde dehydrogenase 3) (MaxLight 750) discontinued

Sign In for Pricing
View Details