What is the catalog number for DAZ3 Antibody - middle region?

The catalog number for DAZ3 Antibody - middle region is ARP40942_P050-25UL.

What sizes are available for DAZ3 Antibody - middle region?

DAZ3 Antibody - middle region is available in the following size(s): 25 µL.

Is DAZ3 Antibody - middle region in stock?

DAZ3 Antibody - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

What buffer is this product supplied in?

The formulation or storage buffer is listed on the product datasheet. If you require a carrier-free or custom formulation, contact us before ordering, as this may involve a made-to-order production timeline.

What dilution range is recommended for immunohistochemistry (IHC) with this antibody?

A starting IHC dilution range is listed on the datasheet, but should be optimized for your specific tissue type and staining protocol.

Can I request a Safety Data Sheet (SDS) for this product?

Yes, safety data sheets are available for hazardous or chemically classified products and can be provided on request or downloaded from the product page.

DAZ3 Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

Deleted in azoospermia 3

Gene Aliases

PDP1679

Gene ID

57054

Swiss Prot

Q2KHN7

Accession Number

NP_065097

Reactivity

Human, Rat, Guinea Pig

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human DAZ3

Target

This gene is a member of the DAZ gene family and is a candidate for the human Y-chromosomal azoospermia factor (AZF) . Its expression is restricted to premeiotic germ cells, particularly in spermatogonia. It encodes an RNA-binding protein that is important

Partner Proteins

UBC

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

PFPAYPRSPFQVTAGYQLPVYNYQAFPAYPNSPFQVATGYQFPVYNYQAF

Applications

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol