Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CPNE1 antibody - N-terminal region (ARP40504_T100)

Click here to learn more about Aviva's By-Request Conjugation Service.//here

Product Specifications

CAS Number

9007-83-4

Gene Name

Copine I

Gene Aliases

CPN1, COPN1

Gene ID

8904

Swiss Prot

Q99829

Accession Number

NP_003906

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CPNE1

Target

Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. CPNE1 is a calcium-dependent protein that also contains two N-terminal type II C2 domains and an integrin A domain-like sequence in the C-terminus. However, the protein does not contain a predicted signal sequence or transmembrane domains. This protein has a broad tissue distribution and it may function in membrane trafficking.Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. This gene encodes a calcium-dependent protein that also contains two N-terminal type II C2 domains and an integrin A domain-like sequence in the C-terminus. However, the encoded protein does not contain a predicted signal sequence or transmembrane domains. This protein has a broad tissue distribution and it may function in membrane trafficking. This gene and the gene for RNA binding motif protein 12 overlap at map location 20q11.21. Sequence analysis identified multiple alternatively spliced variants in the 5' UTR. All variants encode the same protein.

Partner Proteins

UBC; BAG3; BUB3; STK3; FN1; LIG4; TIMM13; TTLL12; ST13; PYGB; ARRB2; SUMO2; UIMC1; HNRNPH1; UBE2O; WTAP; MYCBP; PITPNM2; CCDC22; BCOR; CPNE4; CPNE1; UBE2M; PDCD6; PPP5C; SPTBN1; RDX; MAP2K1; SKIL; ACTB; Cdc42bpb; Etl4; Cenpf; Mycbp2; Alg2; Nono

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

TVQKLRFGIYDIDNKTPELRDDDFLGGAECSLGQIVSSQVLTLPLMLKPG

Applications

IHC, WB

Purification

Protein A purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

1.0 mg/ml

Homology

Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Sheep: 93%; Zebrafish: 79%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

59kDa

Protein Length

537

NCBI Gene Symbol

CPNE1

Host or Source

Rabbit

Protein Name

Copine-1

Gene Name URL

CPNE1

Nucleotide Accession Number

NM_003915

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr892 Rat shRNA Plasmid (Locus ID 288816)
TL700007 1 Kit

Olr892 Rat shRNA Plasmid (Locus ID 288816)

Sign In for Pricing
View Details
Cytochrome P450 1A1 (CYP1A1) Antibody
abx102125-01 100 µL

Cytochrome P450 1A1 (CYP1A1) Antibody

Sign In for Pricing
View Details
Cytochrome P450 1A1 (CYP1A1) Antibody
abx102125-02 200 µL

Cytochrome P450 1A1 (CYP1A1) Antibody

Sign In for Pricing
View Details
Cytochrome P450 1A1 (CYP1A1) Antibody
abx102125-03 1 mL

Cytochrome P450 1A1 (CYP1A1) Antibody

Sign In for Pricing
View Details
RGD1565883 sgRNA CRISPR Lentivector (Rat) (Target 2)
K6427703 1.0 µg DNA

RGD1565883 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
GSPT1 degrader-1
MF-0157263-01 5 mg

GSPT1 degrader-1

Sign In for Pricing
View Details