What is the catalog number for Elf3 antibody - middle region (ARP40156_P050)?

The catalog number for Elf3 antibody - middle region (ARP40156_P050) is ARP40156_P050.

What sizes are available for Elf3 antibody - middle region (ARP40156_P050)?

Elf3 antibody - middle region (ARP40156_P050) is available in the following size(s): 100 µL.

Is Elf3 antibody - middle region (ARP40156_P050) in stock?

Elf3 antibody - middle region (ARP40156_P050) is currently made to order / not held in immediate stock. Contact us for lead time.

Can this product be used for co-immunoprecipitation (Co-IP)?

Suitability for Co-IP depends on the specific antibody and is noted under validated applications on the datasheet. If it isn’t listed, contact our technical support team for guidance based on your target and sample type.

Is this kit compatible with automated liquid handling platforms?

Automation compatibility varies by kit and isn’t always listed on the datasheet. Contact our technical support team with details of your platform so we can confirm with the manufacturer.

What applications has this product been validated for?

Validated applications such as WB, ELISA, IHC, ICC, or FC are listed on the product datasheet. If you need application-specific validation data before ordering, contact our technical support team with the catalogue number.

Elf3 antibody - middle region (ARP40156_P050)

Selected Variant

ARP40156_P050

Size: 100 µL

Product Specifications

CAS Number

9007-83-4

Gene Name

E74-like factor 3

Gene Aliases

ES, je, ESX, jen, ESE-, ESE-1

Gene ID

13710

Swiss Prot

Q3UPW2-2

Accession Number

NP_031947

Reactivity

Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of mouse Elf3

Target

Elf3 is a transcriptional activator that binds and transactivates ETS sequences containing the consensus nucleotide core sequence GGA[AT]. It acts synergistically with POU2F3 to transactivate the SPRR2A promoter and with RUNX1 to transactivate the ANGPT1 promoter (By similarity) . It also transactivates collagenase, CCL20, CLND7, FLG, KRT8, NOS2, PTGS2, SPRR2B, TGFBR2 and TGM3 promoters. IT represses KRT4 promoter activity (By similarity) . It may play an important role in epithelial cell differentiation and tumorigenesis and may be a critical downstream effector of the ERBB2 signaling pathway (By similarity) . It may be associated with mammary gland development and involution. It plays an important role in the regulation of transcription with TATA-less promoters in preimplantation embryos, which is essential in preimplantation development.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

TATPQSSHASDSGGSDVDLDLTESKVFPRDGFPDYKKGEPKHGKRKRGRP

Applications

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 79%; Dog: 86%; Horse: 86%; Human: 79%; Mouse: 100%; Pig: 79%; Rabbit: 79%; Rat: 93%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

41kDa

Protein Length

371

NCBI Gene Symbol

ELF3

Host or Source

Rabbit

Protein Name

ETS-related transcription factor Elf-3

Gene Name URL

Elf3

Nucleotide Accession Number

NM_007921

Price

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calnexin (Endoplasmic Reticulum Marker) (CANX/1541), 0.2mg/mL

BNUB1541-100 1x 100 µL