What is the catalog number for TFAP2E antibody - C-terminal region (ARP40023_T100)?

The catalog number for TFAP2E antibody - C-terminal region (ARP40023_T100) is ARP40023_T100.

What sizes are available for TFAP2E antibody - C-terminal region (ARP40023_T100)?

TFAP2E antibody - C-terminal region (ARP40023_T100) is available in the following size(s): 100 µL.

Is TFAP2E antibody - C-terminal region (ARP40023_T100) in stock?

TFAP2E antibody - C-terminal region (ARP40023_T100) is currently made to order / not held in immediate stock. Contact us for lead time.

Do you offer custom or private-label production of this type of product?

Yes, custom antibody development and private-label production services are available. Contact our sales team to discuss your target, timeline, and quantity requirements.

What is the immunogen used to generate this antibody?

Immunogen or antigen details used to raise this antibody are listed on the product datasheet under immunogen information.

What is the recommended positive control for this assay?

A recommended positive control, where one is specified by the manufacturer, is listed on the datasheet or in the assay protocol.

TFAP2E antibody - C-terminal region (ARP40023_T100)

Product Specifications

CAS Number

9007-83-4

Gene Name

Transcription factor AP-2 epsilon (activating enhancer binding protein 2 epsilon)

Gene Aliases

AP2E, AP-2epsilon

Gene ID

339488

Swiss Prot

Q8IW12

Accession Number

NP_848643

Reactivity

Human, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human TFAP2E

Target

TFAP2E belongs to AP-2 family of transcription factors which play an important role in regulating gene expression during development and differentiation of multiple organs and tissues. It may play an important role in skin biology.

Partner Proteins

UBC

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

FGGPAICAALTAFQNYLLESLKGLDKMFLSSVGSGHGETKASEKDAKHRK

Applications

Purification

Protein A purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol