What is the catalog number for PGBD1 Antibody - C-terminal region?

The catalog number for PGBD1 Antibody - C-terminal region is ARP39704_T100-25UL.

What sizes are available for PGBD1 Antibody - C-terminal region?

PGBD1 Antibody - C-terminal region is available in the following size(s): 25 µL.

Is PGBD1 Antibody - C-terminal region in stock?

PGBD1 Antibody - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product animal-origin-free?

Animal-origin-free status, where applicable, is noted on the datasheet under formulation details.

Does this product need any special customs documentation to be imported to my country?

If you’re outside the EU, UK, or USA, you’re responsible for customs clearance and any related taxes or fees. We provide the standard import documents, such as the Commercial Invoice, Packing List, and Airway Bill, in advance, so let us know early if your customs office needs anything additional for this specific product.

What buffer is this product supplied in?

The formulation or storage buffer is listed on the product datasheet. If you require a carrier-free or custom formulation, contact us before ordering, as this may involve a made-to-order production timeline.

PGBD1 Antibody - C-terminal region

Product Specifications

CAS Number

9007-83-4

Gene Name

PiggyBac transposable element derived 1

Gene Aliases

SCAND4, HUCEP-4, dJ874C20.4

Gene ID

84547

Swiss Prot

Q96JS3

Accession Number

NP_115896

Reactivity

Human, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human PGBD1

Target

PGBD1 belongs to the subfamily of piggyBac transposable element derived (PGBD) genes. The PGBD proteins appear to be novel, with no obvious relationship to other transposases, or other known protein families. This gene product is specifically expressed in the brain, however, its exact function is not known. Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.The piggyBac family of proteins, found in diverse animals, are transposases related to the transposase of the canonical piggyBac transposon from the moth, Trichoplusia ni. This family also includes genes in several genomes, including human, that appear to have been derived from the piggyBac transposons. This gene belongs to the subfamily of piggyBac transposable element derived (PGBD) genes. The PGBD proteins appear to be novel, with no obvious relationship to other transposases, or other known protein families. This gene product is specifically expressed in the brain, however, its exact function is not known.

Partner Proteins

ZSCAN22; PGBD1; ZNF446; SCAND1; ZNF24; TRAF2; MEOX2; NR4A1

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

PQISQPSIVKVYDECKEGVAKMDQIISKYRVRIRSKKWYSILVSYMIDVA

Applications

Purification

Protein A purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol