Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RFX4 antibody - N-terminal region (ARP39699_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

Regulatory factor X, 4 (influences HLA class II expression)

Gene Aliases

NYD-SP10

Gene ID

5992

Swiss Prot

Q33E94

Accession Number

NP_002911

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RFX4

Target

RFX4 is a transcription factors that contain a highly-conserved winged helix DNA binding domain. RFX4 is structurally related to regulatory factors X1, X2, X3, and X5. It has been shown to interact with itself as well as with regulatory factors X2 and X3, but it does not interact with regulatory factor X1. RFX4 may be a transcriptional repressor rather than a transcriptional activator.This gene is a member of the regulatory factor X gene family, which encodes transcription factors that contain a highly-conserved winged helix DNA binding domain. The protein encoded by this gene is structurally related to regulatory factors X1, X2, X3, and X5. It has been shown to interact with itself as well as with regulatory factors X2 and X3, but it does not interact with regulatory factor X1. This protein may be a transcriptional repressor rather than a transcriptional activator. Three transcript variants encoding different isoforms have been described for this gene.This gene is a member of the regulatory factor X gene family, which encodes transcription factors that contain a highly-conserved winged helix DNA binding domain. The protein encoded by this gene is structurally related to regulatory factors X1, X2, X3, and X5. It has been shown to interact with itself as well as with regulatory factors X2 and X3, but it does not interact with regulatory factor X1. This protein may be a transcriptional repressor rather than a transcriptional activator. Three transcript variants encoding different isoforms have been described for this gene.

Partner Proteins

RFX3; RFX2; ESR1; RFX4

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

QQFPQLTTRRLGTRGQSKYHYYGIAVKESSQYYDVMYSKKGAAWVSETGK

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

64kDa

Protein Length

563

NCBI Gene Symbol

RFX4

Host or Source

Rabbit

Protein Name

Transcription factor RFX4

Gene Name URL

RFX4

Nucleotide Accession Number

NM_002920

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rno-miR-146b-5p miRNA Inhibitor
CIR0341-01 10 nmol

Rno-miR-146b-5p miRNA Inhibitor

Sign In for Pricing
View Details
Rno-miR-146b-5p miRNA Inhibitor
CIR0341-02 20 nmol

Rno-miR-146b-5p miRNA Inhibitor

Sign In for Pricing
View Details
ALDH1A1 Protein Vector (Mouse) (pPM-C-HA)
PV153740 500 ng

ALDH1A1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
POP1 siRNA (Human)
CRH7462-01 15 nmol

POP1 siRNA (Human)

Sign In for Pricing
View Details
POP1 siRNA (Human)
CRH7462-02 30 nmol

POP1 siRNA (Human)

Sign In for Pricing
View Details
TGM2 (Transglutaminase 2 (C Polypeptide, Protein-Glutamine-gamma-glutamyltransferase), G-ALPHA-h, GNAH, TG2, TGC) (MaxLight 650)
MBS6230330-01 0.1 mL

TGM2 (Transglutaminase 2 (C Polypeptide, Protein-Glutamine-gamma-glutamyltransferase), G-ALPHA-h, GNAH, TG2, TGC) (MaxLight 650)

Sign In for Pricing
View Details