What is the catalog number for ZIC4 antibody - N-terminal region (ARP39680_P050)?

The catalog number for ZIC4 antibody - N-terminal region (ARP39680_P050) is ARP39680_P050.

What sizes are available for ZIC4 antibody - N-terminal region (ARP39680_P050)?

ZIC4 antibody - N-terminal region (ARP39680_P050) is available in the following size(s): 100 µL.

Is ZIC4 antibody - N-terminal region (ARP39680_P050) in stock?

ZIC4 antibody - N-terminal region (ARP39680_P050) is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product classed as hazardous or restricted for shipping?

Some products are subject to special import/export regulations, dangerous goods handling, or licensing requirements. Where this applies, it’s noted on the product page, and any required extra documents or fees will be confirmed with you before dispatch, never added without your consent.

Can you help me confirm if this product is right for my specific experiment?

Yes, contact us with details of your sample type, species, and intended application, and our specialists will confirm suitability or suggest an alternative from our supplier network if this isn’t the best fit.

What is the purity of this recombinant protein?

Purity, typically assessed by SDS-PAGE, is listed on the datasheet under quality control data.

ZIC4 antibody - N-terminal region (ARP39680_P050)

Selected Variant

ARP39680_P050

Size: 100 µL

Product Specifications

CAS Number

9007-83-4

Gene Name

Zic family member 4

Gene Aliases

FLJ42609, FLJ45833

Gene ID

84107

Swiss Prot

Q8N9L1

Accession Number

NP_115529

Reactivity

Human, Mouse, Cow, Dog, Guinea Pig, Horse, Rabbit

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZIC4

Target

ZIC4 is a member of the ZIC family of C2H2-type zinc finger proteins. Members of this family are important during development, and have been associated with X-linked visceral heterotaxy and holoprosencephaly type 5. This gene is closely linked to the gene encoding zinc finger protein of the cerebellum 1, a related family member on chromosome 3. The specific function of ZIC4 is not yet known.This gene encodes a member of the ZIC family of C2H2-type zinc finger proteins. Members of this family are important during development, and have been associated with X-linked visceral heterotaxy and holoprosencephaly type 5. This gene is closely linked to the gene encoding zinc finger protein of the cerebellum 1, a related family member on chromosome 3. This gene encodes a protein of unknown function.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

MRYKTSLVMRKRLRLYRNTLKESSSSSGHHGPQLTAASSPSVFPGLHEEP

Applications

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 85%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

36kDa

Protein Length

334

NCBI Gene Symbol

ZIC4

Host or Source

Rabbit

Protein Name

Zinc finger protein ZIC 4

Gene Name URL

ZIC4

Nucleotide Accession Number

NM_032153

Price

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AKT1 (Prognostic Marker for Neuroendocrine Tumors) (AKT1/2491), CF647 conjugate, 0.1mg/mL

BNC472491-100 1x 100 µL