Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZIC4 antibody - N-terminal region (ARP39680_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

Zic family member 4

Gene Aliases

FLJ42609, FLJ45833

Gene ID

84107

Swiss Prot

Q8N9L1

Accession Number

NP_115529

Reactivity

Human, Mouse, Cow, Dog, Guinea Pig, Horse, Rabbit

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZIC4

Target

ZIC4 is a member of the ZIC family of C2H2-type zinc finger proteins. Members of this family are important during development, and have been associated with X-linked visceral heterotaxy and holoprosencephaly type 5. This gene is closely linked to the gene encoding zinc finger protein of the cerebellum 1, a related family member on chromosome 3. The specific function of ZIC4 is not yet known.This gene encodes a member of the ZIC family of C2H2-type zinc finger proteins. Members of this family are important during development, and have been associated with X-linked visceral heterotaxy and holoprosencephaly type 5. This gene is closely linked to the gene encoding zinc finger protein of the cerebellum 1, a related family member on chromosome 3. This gene encodes a protein of unknown function.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

MRYKTSLVMRKRLRLYRNTLKESSSSSGHHGPQLTAASSPSVFPGLHEEP

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 85%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

36kDa

Protein Length

334

NCBI Gene Symbol

ZIC4

Host or Source

Rabbit

Protein Name

Zinc finger protein ZIC 4

Gene Name URL

ZIC4

Nucleotide Accession Number

NM_032153

More Discoveries

Explore Other Products

Browse additional items from our catalog

NDUFAF3 Double Nickase Plasmid (m)
sc-426157-NIC 20 µg

NDUFAF3 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
Human GREM2 Knockout A549 cell line
GTR15406243 1 Vial

Human GREM2 Knockout A549 cell line

Sign In for Pricing
View Details
Recombinant Rhesus Macaque P2RY10 Protein, His (Fc)-Avi-tagged
P2RY10-3088R 50 µg

Recombinant Rhesus Macaque P2RY10 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
EFCAB1 (NM_024593) Human Over-expression Lysate
LS079645-20ug 20 µg

EFCAB1 (NM_024593) Human Over-expression Lysate

Sign In for Pricing
View Details
CTRB2 Human shRNA Plasmid Kit (Locus ID 440387)
TL313658 1 Kit

CTRB2 Human shRNA Plasmid Kit (Locus ID 440387)

Sign In for Pricing
View Details
Rabbit myeloid differential protein-2 (MD-2) ELISA Kit
EIA06026Rb 1 Kit

Rabbit myeloid differential protein-2 (MD-2) ELISA Kit

Sign In for Pricing
View Details