What is the catalog number for HOXB4 Antibody - N-terminal region?

The catalog number for HOXB4 Antibody - N-terminal region is ARP39581_T100-25UL.

What sizes are available for HOXB4 Antibody - N-terminal region?

HOXB4 Antibody - N-terminal region is available in the following size(s): 25 µL.

Is HOXB4 Antibody - N-terminal region in stock?

HOXB4 Antibody - N-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

Does this cell line or biologic require a Material Transfer Agreement (MTA)?

Some products, including certain cell lines, plasmids, and tissue cultures, are subject to intellectual property terms and may require an MTA before we can ship. We’ll inform you in advance if this product requires one, and additional handling fees may apply.

What should I do if I need to report a performance issue with a specific lot of this product?

Provide the catalogue number, product name, lot number, and your experimental results to our technical support team. They’ll investigate and, if needed, escalate to the manufacturer, provided the product was used before expiry and stored correctly.

What is the isotype of this antibody?

Isotype information such as IgG1 or IgG2a is listed in the product specifications on the datasheet, relevant for selecting compatible detection reagents.

HOXB4 Antibody - N-terminal region

Product Specifications

CAS Number

9007-83-4

Gene Name

Homeobox B4

Gene Aliases

HOX2, HOX2F, HOX-2.6

Gene ID

3214

Swiss Prot

P17483

Accession Number

NP_076920

Reactivity

Human, Mouse, Rat, Cow, Dog, Pig

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human HOXB4

Target

HOXB4 is a nuclear protein with a homeobox DNA-binding domain. The protein functions as a sequence-specific transcription factor that is involved in development. Intracellular or ectopic expression of this protein expands hematopoietic stem and progenitor cells in vivo and in vitro, making it a potential candidate for therapeutic stem cell expansion.This gene is a member of the Antp homeobox family and encodes a nuclear protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded protein functions as a sequence-specific transcription factor that is involved in development. Intracellular or ectopic expression of this protein expands hematopoietic stem and progenitor cells in vivo and in vitro, making it a potential candidate for therapeutic stem cell expansion.

Partner Proteins

DDB1; RBX1; CUL4A; CREBBP; EP300; MEIS1

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

FLINSNYVDPKFPPCEEYSQSDYLPSDHSPGYYAGGQRRESSFQPEAGFG

Applications

Purification

Protein A purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol