What is the catalog number for PRDM10 Antibody - middle region?

The catalog number for PRDM10 Antibody - middle region is ARP39405_P050-25UL.

What sizes are available for PRDM10 Antibody - middle region?

PRDM10 Antibody - middle region is available in the following size(s): 25 µL.

Is PRDM10 Antibody - middle region in stock?

PRDM10 Antibody - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

What do I do if this product arrives with reduced ice or a damaged cold-chain package?

Report this to us immediately with photos and your order reference. Our specialists will assess whether the product is still usable given the cold-chain interruption, and will arrange a replacement or credit if it isn’t.

What host species was used to raise this antibody?

The host species used in production is listed under product specifications on the datasheet, and is relevant when selecting a compatible secondary antibody for your assay.

What is the difference between this product and a similar catalogue number?

Differences typically involve clone, conjugate, host species, or validated applications. Compare the respective datasheets, or contact us with both catalogue numbers for a direct comparison.

PRDM10 Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

PR domain containing 10

Gene Aliases

PFM7, TRIS

Gene ID

56980

Swiss Prot

Q9NQV6

Accession Number

NP_064613

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PRDM10

Target

The protein encoded by this gene is a transcription factor that contains C2H2-type zinc-fingers. It also contains a positive regulatory domain, which has been found in several other zinc-finger transcription factors including those involved in B cell differentiation and tumor suppression. Studies of the mouse counterpart suggest that this protein may be involved in the development of the central nerve system (CNS), as well as in the pathogenesis of neuronal storage disease. Multiple alternatively spliced transcript variants encoding distinct isoforms have been observed.

Partner Proteins

REL; CUL1; BAP1

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

VATPVTTGQVKAVTSGHYVLSESQSELEEKQTSALSGGVQVEPPAHSDSL

Applications

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol