Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOXC5 antibody - N-terminal region (ARP39378_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

Homeobox C5

Gene Aliases

CP11, HOX3, HOX3D

Gene ID

3222

Swiss Prot

Q00444

Accession Number

NP_061826

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human HOXC5

Target

This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene, HOXC5, is one of several homeobox HOXC genes located in a cluster on chromosome 12. Three genes, HOXC5, HOXC4 and HOXC6, share a 5' non-coding exon. Transcripts may include the shared exon spliced to the gene-specific exons, or they may include only the gene-specific exons. Two alternatively spliced variants have been described for HOXC5. The transcript variant which includes the shared exon apparently doesn't encode a protein. The protein-coding transcript variant contains gene-specific exons only.This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, which are located on different chromosomes and consist of 9 to 11 genes arranged in tandem. This gene, HOXC5, is one of several homeobox HOXC genes located in a cluster on chromosome 12. Three genes, HOXC5, HOXC4 and HOXC6, share a 5' non-coding exon. Transcripts may include the shared exon spliced to the gene-specific exons, or they may include only the gene-specific exons. Two alternatively spliced variants have been described for HOXC5. The transcript variant which includes the shared exon apparently doesn't encode a protein. The protein-coding transcript variant contains gene-specific exons only.

Partner Proteins

UBC

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

MSSYVANSFYKQSPNIPAYNMQTCGNYGSASEVQASRYCYGGLDLSITFP

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

25kDa

Protein Length

222

NCBI Gene Symbol

HOXC5

Host or Source

Rabbit

Protein Name

Homeobox protein Hox-C5

Gene Name URL

HOXC5

Nucleotide Accession Number

NM_018953

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Cardiotrophin 1 (CT-1) ELISA Kit
NSL0726Po 96 Tests

Porcine Cardiotrophin 1 (CT-1) ELISA Kit

Sign In for Pricing
View Details
FAST discontinued
389020 200 µL

FAST discontinued

Sign In for Pricing
View Details
SLN Human Pre-designed siRNA Set A
HY-RS13381 1 Set

SLN Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
Tex19-2 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
68196124 3x 1.0µg DNA

Tex19-2 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Bovine Fibroblast growth factor 21,FGF21 ELISA KIT
JOT-EK2209Bo 96 wells

Bovine Fibroblast growth factor 21,FGF21 ELISA KIT

Sign In for Pricing
View Details
CATSPER4 ORF Vector (Human) (pORF)
ORF012581 1.0 µg DNA

CATSPER4 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details