What is the catalog number for ARC Antibody - N-terminal region?

The catalog number for ARC Antibody - N-terminal region is ARP39182_P050-25UL.

What sizes are available for ARC Antibody - N-terminal region?

ARC Antibody - N-terminal region is available in the following size(s): 25 µL.

Is ARC Antibody - N-terminal region in stock?

ARC Antibody - N-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

What is the recommended positive control for this assay?

A recommended positive control, where one is specified by the manufacturer, is listed on the datasheet or in the assay protocol.

How should this product be stored?

Storage conditions depend on the specific reagent and are listed on the product datasheet, with most antibodies and proteins requiring -20°C unless stated otherwise. It is your responsibility to store the product correctly immediately upon receipt; damage from improper storage after delivery is not eligible for replacement.

Is this product animal-origin-free?

Animal-origin-free status, where applicable, is noted on the datasheet under formulation details.

ARC Antibody - N-terminal region

Product Specifications

CAS Number

9007-83-4

Gene Name

Activity-regulated cytoskeleton-associated protein

Gene Aliases

HArc, Arg3.1

Gene ID

23237

Swiss Prot

Q7LC44

Accession Number

NP_056008

Reactivity

Human, Mouse, Rat, Cow, Goat, Guinea Pig

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ARC

Target

ARC is required for consolidation of synaptic plasticity as well as formation of long-term memory. It regulates endocytosis of AMPA receptors in response to synaptic activity. The protein is also required for homeostatic synaptic scaling of AMPA receptors.

Partner Proteins

UBE3A; UBC; KRT15

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

ELDHRTSGGLHAYPGPRGGQVAKPNVILQIGKCRAEMLEHVRRTHRHLLA

Applications

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol