What is the catalog number for OTX1 antibody - C-terminal region (ARP39103_T100)?

The catalog number for OTX1 antibody - C-terminal region (ARP39103_T100) is ARP39103_T100.

What sizes are available for OTX1 antibody - C-terminal region (ARP39103_T100)?

OTX1 antibody - C-terminal region (ARP39103_T100) is available in the following size(s): 100 µL.

Is OTX1 antibody - C-terminal region (ARP39103_T100) in stock?

OTX1 antibody - C-terminal region (ARP39103_T100) is currently made to order / not held in immediate stock. Contact us for lead time.

Is this kit compatible with automated liquid handling platforms?

Automation compatibility varies by kit and isn’t always listed on the datasheet. Contact our technical support team with details of your platform so we can confirm with the manufacturer.

What applications has this product been validated for?

Validated applications such as WB, ELISA, IHC, ICC, or FC are listed on the product datasheet. If you need application-specific validation data before ordering, contact our technical support team with the catalogue number.

How do I reconstitute this lyophilized product?

Reconstitution instructions, including the recommended diluent and final concentration, are provided on the datasheet. Aliquot immediately after reconstitution to avoid repeated freeze-thaw cycles.

OTX1 antibody - C-terminal region (ARP39103_T100)

Selected Variant

ARP39103_T100

Size: 100 µL

Product Specifications

CAS Number

9007-83-4

Gene Name

Orthodenticle homeobox 1

Gene ID

5013

Swiss Prot

P32242

Accession Number

NP_055377

Reactivity

Human, Mouse, Rat, Cow, Dog, Horse, Pig, Sheep, Zebrafish

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human OTX1

Target

OTX1 is a member of the bicoid sub-family of homeodomain-containing transcription factors. OTX1 acts as a transcription factor and may play a role in brain and sensory organ development. A similar protein in mice is required for proper brain and sensory organ development and can cause epilepsy.This gene encodes a member of the bicoid sub-family of homeodomain-containing transcription factors. The encoded protein acts as a transcription factor and may play a role in brain and sensory organ development. A similar protein in mice is required for proper brain and sensory organ development and can cause epilepsy.

Partner Proteins

KRTAP10-3; KRTAP10-8; KRTAP10-5; KRTAP10-11; KRTAP10-1; KRTAP10-9; KRTAP12-2; LCE2D; LCE2A; LCE1B; LCE4A; MGAT5B; KRTAP3-3; KRTAP4-2; KRTAP4-7; KRTAP9-4; KRTAP9-2; KRTAP4-11; GEMIN8P4; KRTAP5-6; KRTAP26-1; KRTAP12-4; KRTAP3-2; KCNK16; KRTAP4-12; RGS17; RB

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

HHQGYGGSGLAFNSADCLDYKEPGAAAASSAWKLNFNSPDCLDYKDQASW

Applications

Purification

Protein A purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

1.0 mg/ml

Homology

Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Sheep: 93%; Zebrafish: 83%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

37kDa

Protein Length

354

NCBI Gene Symbol

OTX1

Host or Source

Rabbit

Protein Name

Homeobox protein OTX1

Gene Name URL

OTX1

Nucleotide Accession Number

NM_014562

Price

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

A03613-1-carrier-free 100 µg/Vial