Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zbtb43 antibody - C-terminal region (ARP39048_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

Zinc finger and BTB domain containing 43

Gene Aliases

Zfp297, Zfp297b, mKIAA0414, 1700010E06Rik

Gene ID

71834

Swiss Prot

Q9DAI4

Accession Number

NP_082223

Reactivity

Human, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit

Target

Zbtb43 may be involved in transcriptional regulation.

Partner Proteins

Gtf2e1; Pou5f1

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

HMKIHTGIKPYECNICAKRFMWRDSFHRHVTSCTKSYEAAKAEQNTTEAN

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

57kDa

Protein Length

504

NCBI Gene Symbol

ZBTB43

Host or Source

Rabbit

Protein Name

Zinc finger and BTB domain-containing protein 43

Gene Name URL

Zbtb43

Nucleotide Accession Number

NM_027947

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kcnv2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4164405 3x 1.0 µg

Kcnv2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Rb2 p130 (RBL2) (NM_005611) Human Tagged ORF Clone Lentiviral Particle
RC205380L4V 200 µL

Rb2 p130 (RBL2) (NM_005611) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
MDH1, CT (Malate Dehydrogenase, Cytoplasmic, Cytosolic Malate Dehydrogenase, MDHA)
M2115-35A 200 µL

MDH1, CT (Malate Dehydrogenase, Cytoplasmic, Cytosolic Malate Dehydrogenase, MDHA)

Sign In for Pricing
View Details
SCN3A (Sodium Channel Protein Type 3 Subunit alpha, Sodium Channel Protein Brain III Subunit alpha, Sodium Channel Protein Type III Subunit alpha, Voltage-gated Sodium Channel Subtype III, Voltage-gated Sodium Channel Subunit alpha Nav1.3, KIAA1356, NAC3)
MBS6154843-01 0.1 mL

SCN3A (Sodium Channel Protein Type 3 Subunit alpha, Sodium Channel Protein Brain III Subunit alpha, Sodium Channel Protein Type III Subunit alpha, Voltage-gated Sodium Channel Subtype III, Voltage-gated Sodium Channel Subunit alpha Nav1.3, KIAA1356, NAC3)

Sign In for Pricing
View Details
SCN3A (Sodium Channel Protein Type 3 Subunit alpha, Sodium Channel Protein Brain III Subunit alpha, Sodium Channel Protein Type III Subunit alpha, Voltage-gated Sodium Channel Subtype III, Voltage-gated Sodium Channel Subunit alpha Nav1.3, KIAA1356, NAC3)
MBS6154843-02 5x 0.1 mL

SCN3A (Sodium Channel Protein Type 3 Subunit alpha, Sodium Channel Protein Brain III Subunit alpha, Sodium Channel Protein Type III Subunit alpha, Voltage-gated Sodium Channel Subtype III, Voltage-gated Sodium Channel Subunit alpha Nav1.3, KIAA1356, NAC3)

Sign In for Pricing
View Details
GPR50, ID (GPR50, Melatonin-related receptor, G protein-coupled receptor 50, H9) (PE)
MBS6303952-01 0.2 mL

GPR50, ID (GPR50, Melatonin-related receptor, G protein-coupled receptor 50, H9) (PE)

Sign In for Pricing
View Details