What is the catalog number for ELL Antibody - N-terminal region?

The catalog number for ELL Antibody - N-terminal region is ARP38813_T100-25UL.

What sizes are available for ELL Antibody - N-terminal region?

ELL Antibody - N-terminal region is available in the following size(s): 25 µL.

Is ELL Antibody - N-terminal region in stock?

ELL Antibody - N-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

What dilution range is recommended for immunohistochemistry (IHC) with this antibody?

A starting IHC dilution range is listed on the datasheet, but should be optimized for your specific tissue type and staining protocol.

Can I request a Safety Data Sheet (SDS) for this product?

Yes, safety data sheets are available for hazardous or chemically classified products and can be provided on request or downloaded from the product page.

Can this product be used for co-immunoprecipitation (Co-IP)?

Suitability for Co-IP depends on the specific antibody and is noted under validated applications on the datasheet. If it isn’t listed, contact our technical support team for guidance based on your target and sample type.

ELL Antibody - N-terminal region

Product Specifications

CAS Number

9007-83-4

Gene Name

Elongation factor RNA polymerase II

Gene Aliases

MEN, ELL1, PPP1R68, C19orf17

Gene ID

8178

Swiss Prot

P55199

Accession Number

NP_006523

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ELL

Target

ELL was shown to encode a previously uncharacterized elongation factor that can increase the catalytic rate of RNA polymerase II transcription by suppressing transient pausing by polymerase at multiple sites along the DNA. Functionally, ELL resembles Elongin (SIII), a transcription elongation factor regulated by the product of the von Hippel-Lindau (VHL) tumor suppressor gene.

Partner Proteins

UBC; LOC100363176; SNF8; MCM2; Polr2e; Polr2l; Polr2h; Polr2d; Polr2a; Polr2c; Polr2i; Polr2b; Polr2j; Polr2g; Polr2f; EAF1; ICE2; AFF4; PPP1CA; ICE1; MED26; MLLT3; CDK9; TFPT; KMT2A; MLLT1; USPL1; EAF2; HNRNPU; TP53; ZHX1; SIRT2

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

GLSCGRVSDGSKVSVFHVKLTDSALRAFESYRARQDSVSLRPSIRFQGSQ

Applications

IHC, WB

Purification

Protein A purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol