What is the catalog number for TIMELESS antibody - C-terminal region (ARP38404_T100)?

The catalog number for TIMELESS antibody - C-terminal region (ARP38404_T100) is ARP38404_T100.

What sizes are available for TIMELESS antibody - C-terminal region (ARP38404_T100)?

TIMELESS antibody - C-terminal region (ARP38404_T100) is available in the following size(s): 100 µL.

Is TIMELESS antibody - C-terminal region (ARP38404_T100) in stock?

TIMELESS antibody - C-terminal region (ARP38404_T100) is currently made to order / not held in immediate stock. Contact us for lead time.

What buffer is this product supplied in?

The formulation or storage buffer is listed on the product datasheet. If you require a carrier-free or custom formulation, contact us before ordering, as this may involve a made-to-order production timeline.

What dilution range is recommended for immunohistochemistry (IHC) with this antibody?

A starting IHC dilution range is listed on the datasheet, but should be optimized for your specific tissue type and staining protocol.

Can I request a Safety Data Sheet (SDS) for this product?

Yes, safety data sheets are available for hazardous or chemically classified products and can be provided on request or downloaded from the product page.

TIMELESS antibody - C-terminal region (ARP38404_T100)

Product Specifications

CAS Number

9007-83-4

Gene Name

Timeless homolog (Drosophila)

Gene Aliases

TIM, TIM1, hTIM

Gene ID

8914

Swiss Prot

Q9UNS1

Accession Number

NP_003911

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Sheep, Yeast

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human TIMELESS

Target

The human Timeless protein interacts with both the circadian clock protein cryptochrome 2 and with the cell cycle checkpoint proteins Chk1 and the ATR-ATRIP complex and plays an important role in the DNA damage checkpoint response. Down-regulation of Timeless in human cells seriously compromises replication and intra-S checkpoints, indicating an intimate connection between the circadian cycle and the DNA damage checkpoints that is in part mediated by the Timeless protein.

Partner Proteins

UBC; TUT1; TF; XRCC1; FKBP3; SP1; SUMO2; Tipin; Timeless; ZSCAN1; PCBD1; CRY1; PER2; PER1; CLSPN; PCNA; per; Clock; ATRIP; CRY2; CHEK1

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

EEEDAVGKEPLKAAPKKRQLLDSDEEQEEDEGRNRAPELGAPGIQKKKRY

Applications

Purification

Protein A purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol