What is the catalog number for Nr5a2 Antibody - C-terminal region?

The catalog number for Nr5a2 Antibody - C-terminal region is ARP38387_P050-25UL.

What sizes are available for Nr5a2 Antibody - C-terminal region?

Nr5a2 Antibody - C-terminal region is available in the following size(s): 25 µL.

Is Nr5a2 Antibody - C-terminal region in stock?

Nr5a2 Antibody - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

What documentation should I request if this product is used for a regulated or intellectual-property-sensitive application?

If the product is subject to intellectual property protections, we’ll advise on any MTA or usage restrictions before shipping. Let us know your intended end use so we can confirm what’s required upfront.

Is this antibody conjugated?

Conjugation status, such as unconjugated, HRP, FITC, or biotin, is specified in the product name and confirmed on the datasheet.

What is the sensitivity of this ELISA kit?

Assay sensitivity, including the minimum detectable dose, is listed on the datasheet. Kits that are assembled on order typically ship within 2-4 weeks.

Nr5a2 Antibody - C-terminal region

Product Specifications

CAS Number

9007-83-4

Gene Aliases

Ftf, Lrh-1

Gene ID

60349

Swiss Prot

Q9QWM1

Accession Number

NP_068510

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Nr5a2

Target

Nr5a2 is an orphan nuclear receptor that may bind DNA and activate gene transcription.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

QTEKFGQLLLRLPEIRAISKQAEDYLYYKHVNGDVPYNNLLIEMLHAKRA

Applications

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol