Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SOX4 antibody - N-terminal region (ARP38234_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

SRY (sex determining region Y) -box 4

Gene Aliases

CSS10, EVI16

Gene ID

6659

Swiss Prot

Q06945

Accession Number

NP_003098

Reactivity

Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SOX4

Target

SOX4 is a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. It may act as a transcriptional regulator after forming a protein complex with other proteins, such as syndecan binding protein (syntenin) . The protein may function in the apoptosis pathway leading to cell death as well as to tumorigenesis and may mediate downstream effects of parathyroid hormone (PTH) and PTH-related protein (PTHrP) in bone development. The solution structure has been resolved for the HMG-box of a similar mouse protein.This intronless gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins, such as syndecan binding protein (syntenin) . The protein may function in the apoptosis pathway leading to cell death as well as to tumorigenesis and may mediate downstream effects of parathyroid hormone (PTH) and PTH-related protein (PTHrP) in bone development. The solution structure has been resolved for the HMG-box of a similar mouse protein. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Partner Proteins

TAF5; UBE2I; ELAVL1; TP53; MDM2; EP300; tat; SDCBP

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

STASTGGKADDPSWCKTPSGHIKRPMNAFMVWSQIERRKIMEQSPDMHNA

Applications

IHC, WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 100%; Dog: 100%; Goat: 91%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

47 kDa

Specificity

Peptide immunogen shares 93% with human SOX11.

Protein Length

474

NCBI Gene Symbol

SOX4

Host or Source

Rabbit

Protein Name

Transcription factor SOX-4

Gene Name URL

SOX4

Nucleotide Accession Number

NM_003107

More Discoveries

Explore Other Products

Browse additional items from our catalog

CRTC3 (NM_022769) Human Untagged Clone
SC112417 10 µg

CRTC3 (NM_022769) Human Untagged Clone

Sign In for Pricing
View Details
Anti-OPAL1 Purified
MBS1801428-01 0.1 mg

Anti-OPAL1 Purified

Sign In for Pricing
View Details
Anti-OPAL1 Purified
MBS1801428-02 5x 0.1 mg

Anti-OPAL1 Purified

Sign In for Pricing
View Details
Kcnk2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV655011 1.0 µg DNA

Kcnk2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Lentiviral human ZMAT1 shRNA (UAS) - Lentiviral human ZMAT1 shRNA (UAS, GFP) plasmid
GTR15107962 1 Vial

Lentiviral human ZMAT1 shRNA (UAS) - Lentiviral human ZMAT1 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
CDK13 rabbit pAb
ES10516-01 50 µL

CDK13 rabbit pAb

Sign In for Pricing
View Details