Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ighmbp2 antibody - N-terminal region (ARP38126_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

Immunoglobulin mu binding protein 2

Gene Aliases

A, s, AEP, Smb, nmd, sma, Catf, RIPE, Smbp, Smub, Catf1, Smbp2, Smbp-2, Smubp2, RIPE3b1

Gene ID

20589

Swiss Prot

P40694

Accession Number

NP_033238

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Target

Ighmbp2 is a 5' to 3' helicase that unwinds RNA and DNA duplices in an ATP-dependent reaction. Ighmbp2 acts as a transcription regulator. Ighmbp2 is required for the transcriptional activation of the flounder liver-type antifreeze protein gene. Ighmbp2 exhibits strong binding specificity to the enhancer element B of the flounder antifreeze protein gene intron. Ighmbp2 binds to the insulin II gene RIPE3B enhancer region. Ighmbp2 may be involved in translation.Ighmbp2 is a DNA-binding protein specific to 5'-phosphorylated single-stranded guanine-rich sequence related to the immunoglobulin mu chain switch region.Ighmbp2 preferentially binds to the 5'-GGGCT-3' motif. Ighmbp2 interacts with tRNA-Tyr.

Partner Proteins

Gtf3c1; Hnrnph1; Ruvbl1; Abt1; Zbtb14; Tyr; Ighmbp2; Ruvbl2; Hspa1b; Slit3; Robo1

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

QLLELERDAEVEERRSWQEHSSLRELQSRGVCLLKLQVSSQRTGLYGQRL

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

109 kDa

Protein Length

993

NCBI Gene Symbol

IGHMBP2

Host or Source

Rabbit

Protein Name

DNA-binding protein SMUBP-2

Gene Name URL

Ighmbp2

Nucleotide Accession Number

NM_009212

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse P2rx4 shRNA (UAS) - Lentiviral mouse P2rx4 shRNA (UAS) (25)
GTR15170561 1 Vial

Lentiviral mouse P2rx4 shRNA (UAS) - Lentiviral mouse P2rx4 shRNA (UAS) (25)

Sign In for Pricing
View Details
PHACTR3 sgRNA CRISPR Lentivector (Human) (Target 2)
K1637203 1.0 µg DNA

PHACTR3 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
DCP2 siRNA (Mouse)
MBS8229697-01 15 nmol

DCP2 siRNA (Mouse)

Sign In for Pricing
View Details
DCP2 siRNA (Mouse)
MBS8229697-02 30 nmol

DCP2 siRNA (Mouse)

Sign In for Pricing
View Details
DCP2 siRNA (Mouse)
MBS8229697-03 5x 30 nmol

DCP2 siRNA (Mouse)

Sign In for Pricing
View Details
Hhipl2 3'UTR Luciferase Stable Cell Line
TU109492 1.0 mL

Hhipl2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details