What is the catalog number for Trp73 Antibody - N-terminal region?

The catalog number for Trp73 Antibody - N-terminal region is ARP37898_P050-25UL.

What sizes are available for Trp73 Antibody - N-terminal region?

Trp73 Antibody - N-terminal region is available in the following size(s): 25 µL.

Is Trp73 Antibody - N-terminal region in stock?

Trp73 Antibody - N-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

Is antigen retrieval required for IHC with this antibody?

Recommended antigen retrieval methods, where applicable, are listed on the datasheet under the IHC protocol section.

What temperature does this product ship at?

Shipping temperature is chosen based on the product’s stability needs, ranging from ambient to dry ice, and is indicated on the product page. Any related shipping fee is shown clearly in your quotation.

What is the molecular weight of the target protein?

Molecular weight information, where applicable, is listed on the datasheet under target details, useful for confirming the correct band on western blot.

Trp73 Antibody - N-terminal region

Product Specifications

CAS Number

9007-83-4

Gene Name

Transformation related protein 73

Gene Aliases

P7, TAp, p73, Tp73, TAp73, delta, deltaNp73

Gene ID

22062

Swiss Prot

Q9JJP2

Accession Number

NP_035772

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Target

Trp73 participates in the apoptotic response to DNA damage. Isoforms containing the transactivation domain are pro-apoptotic, isoforms lacking the domain are anti-apoptotic and block the function of p53 and transactivating p73 isoforms. Trp73 may be a tumor suppressor protein.

Partner Proteins

Mapk8; Trp53; Med16; Trp73; Trp63

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

SNMDVFHLQGMAQFNLLSSAMDQMGSRAAPASPYTPEHAASAPTHSPYAQ

Applications

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol