Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gria1 antibody - N-terminal region (ARP37670_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

Glutamate receptor, ionotropic, AMPA1 (alpha 1)

Gene Aliases

Gl, HI, Glr, Glu, Glr1, Glur, Glr-1, GluA1, GluRA, Glur1, HIPA1, GluR-A, Glur-1, gluR-K1, 2900051M01Rik

Gene ID

14799

Swiss Prot

P23818

Accession Number

NP_001106796

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish

Target

Gria1 is an ionotropic glutamate receptor. L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. Binding of the excitatory neurotransmitter L-glutamate induces a conformation change, leading to the opening of the cation channel, and thereby converts the chemical signal to an electrical impulse. The receptor then desensitizes rapidly and enters a transient inactive state, characterized by the presence of bound agonist. In the presence of CACNG4 or CACNG7 or CACNG8, shows resensitization which is characterized by a delayed accumulation of current flux upon continued application of glutamate.

Partner Proteins

Lrp1; Grin2c; Grin2a; Grin1; Gria2; Eps8; Cacng2; Sqstm1; HOMER2

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

CGALHVCFITPSFPVDTSNQFVLQLRPELQEALISIIDHYKWQTFVYIYD

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

102kDa

Protein Length

907

NCBI Gene Symbol

GRIA1

Host or Source

Rabbit

Protein Name

Glutamate receptor 1

Gene Name URL

Gria1

Nucleotide Accession Number

NM_001113325

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Placental Thrombin Inhibitor (PTI) ELISA Kit
CK-bio-12914-01 48 Tests

Human Placental Thrombin Inhibitor (PTI) ELISA Kit

Sign In for Pricing
View Details
Human Placental Thrombin Inhibitor (PTI) ELISA Kit
CK-bio-12914-02 96 Tests

Human Placental Thrombin Inhibitor (PTI) ELISA Kit

Sign In for Pricing
View Details
Human Placental Thrombin Inhibitor (PTI) ELISA Kit
CK-bio-12914-03 5x 96 Tests

Human Placental Thrombin Inhibitor (PTI) ELISA Kit

Sign In for Pricing
View Details
Human Placental Thrombin Inhibitor (PTI) ELISA Kit
CK-bio-12914-04 10x 96 Tests

Human Placental Thrombin Inhibitor (PTI) ELISA Kit

Sign In for Pricing
View Details
ACTB (Actin, beta, PS1TP5BP1) (MaxLight 490)
243057-ML490 100 µL

ACTB (Actin, beta, PS1TP5BP1) (MaxLight 490)

Sign In for Pricing
View Details
USP8 Protein Vector (Mouse) (pPB-N-His)
PV244679 500 ng

USP8 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details