What is the catalog number for Nr5a1 Antibody - C-terminal region (ARP37470_P050)?

The catalog number for Nr5a1 Antibody - C-terminal region (ARP37470_P050) is ARP37470_P050.

What sizes are available for Nr5a1 Antibody - C-terminal region (ARP37470_P050)?

Nr5a1 Antibody - C-terminal region (ARP37470_P050) is available in the following size(s): 100 µL.

Is Nr5a1 Antibody - C-terminal region (ARP37470_P050) in stock?

Nr5a1 Antibody - C-terminal region (ARP37470_P050) is currently made to order / not held in immediate stock. Contact us for lead time.

What dilution range is recommended for immunohistochemistry (IHC) with this antibody?

A starting IHC dilution range is listed on the datasheet, but should be optimized for your specific tissue type and staining protocol.

Can I request a Safety Data Sheet (SDS) for this product?

Yes, safety data sheets are available for hazardous or chemically classified products and can be provided on request or downloaded from the product page.

Can this product be used for co-immunoprecipitation (Co-IP)?

Suitability for Co-IP depends on the specific antibody and is noted under validated applications on the datasheet. If it isn’t listed, contact our technical support team for guidance based on your target and sample type.

Nr5a1 Antibody - C-terminal region (ARP37470_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

Nuclear receptor subfamily 5, group A, member 1

Gene Aliases

E, SF, Ad4, ELP, SF-, SF1, SF-1, Ad4BP, ELP-3, Ftzf1, STF-1, Ftz-F1

Gene ID

26423

Swiss Prot

P33242

Accession Number

NP_620639

Reactivity

Human, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit, Sheep

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Nr5a1

Target

Nr5a1 is a transcriptional activator. It seems to be essential for sexual differentiation and formation of the primary steroidogenic tissues. It binds to the Ad4 site found in the promoter region of steroidogenic P450 genes such as CYP11A, CYP11B and CYP21B. Nr5a1 also regulates the AMH/Muellerian inhibiting substance gene as well as the AHCH and STAR genes. 5'-YCAAGGYC-3' and 5'-RRAGGTCA-3' are the consensus sequences for the recognition by NR5A1. The SFPQ-NONO-NR5A1 complex binds to the CYP17 promoter and regulates basal and cAMP-dependent transcriptional avtivity. Transcription repressor of the Moloney leukemia virus long terminal repeat in undifferentiated murine embryonal carcinoma cells. Nr5a1 binds phosphatidylcholine and phospholipids with a phosphatidylinositol (PI) headgroup, in particular phosphatidyl (3,4) bisphosphate, phosphatidyl (3,5) bisphosphate and phosphatidyl (3,4,5) triphosphate. Nr5a1 is activated by the phosphorylation of NR5A1 by HIPK3 leading to increased steroidogenic gene expression upon cAMP signaling pathway stimulation.

Partner Proteins

Pitx1; Nfya; Pin1; Sumo1; Ubc; Egr1; Mir383; Ncoa1; Sumo2; Ppargc1a; Lhb; Tbx19; Sox9; Nr0b2; Nr0b1; Ncoa2

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

VADQMTLLQNCWSELLVLDHIYRQVQYGKEDSILLVTGQEVELSTVAVQA

Applications

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 79%; Guinea Pig: 93%; Horse: 86%; Human: 86%; Mouse: 100%; Rabbit: 86%; Rat: 100%; Sheep: 79%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

52kDa

Protein Length

462

NCBI Gene Symbol

NR5A1

Host or Source

Rabbit

Protein Name

Steroidogenic factor 1

Gene Name URL

Nr5a1

Nucleotide Accession Number

NM_139051

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD43 (84-3C1), CF647 conjugate, 0.1mg/mL

BNC470342-500 1x 500 µL