Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ptges2 Antibody - N-terminal region (ARP37463_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

Prostaglandin E synthase 2

Gene Aliases

Gbf1, Pges2, C79137, Mpges2, 0610038H10Rik

Gene ID

96979

Swiss Prot

Q8BWM0

Accession Number

NP_598544

Reactivity

Human, Mouse, Rat

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of MOUSE Ptges2

Target

The protein encoded by this gene is a Golgi membrane-associated prostaglandin E synthase candidate, which is capable of catalyzing the conversion of prostaglandin H2 to prostaglandin E2 in vitro. However, a study using mice deficient of this gene suggests that this enzyme does not contribute to prostaglandin E2 biosynthesis in vivo. This protein is synthesized as a Golgi membrane-bound protein, but its N-terminal hydrophobic region is cleaved off during protein maturation to produce the predominant soluble truncated form that still retains the enzyme activity. This soluble protein also has been shown to activate the transcription regulated by a gamma-interferon-activated transcription element (GATE), possibly via an interaction with CAAAT/enhancer-binding protein-beta.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

RLLGAAALALGGALGLYHTVRWHQRSQDLRAERSAAQLPLSNSLQLTLYQ

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Human: 79%; Mouse: 100%; Rat: 79%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

43kDa

Protein Length

384

NCBI Gene Symbol

PTGES2

Host or Source

Rabbit

Protein Name

Prostaglandin E synthase 2

Gene Name URL

Ptges2

Nucleotide Accession Number

NM_133783

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Clathrin heavy chain linker domain-containing protein 1 (CLHC1) ELISA Kit
abx507279 96 Tests

Rat Clathrin heavy chain linker domain-containing protein 1 (CLHC1) ELISA Kit

Sign In for Pricing
View Details
Recombinant Staphylococcus saprophyticus subsp. saprophyticus Metallothiol transferase fosB (fosB)
MBS1337289-01 0.02 mg (E-Coli)

Recombinant Staphylococcus saprophyticus subsp. saprophyticus Metallothiol transferase fosB (fosB)

Sign In for Pricing
View Details
Recombinant Staphylococcus saprophyticus subsp. saprophyticus Metallothiol transferase fosB (fosB)
MBS1337289-02 0.1 mg (E-Coli)

Recombinant Staphylococcus saprophyticus subsp. saprophyticus Metallothiol transferase fosB (fosB)

Sign In for Pricing
View Details
Recombinant Staphylococcus saprophyticus subsp. saprophyticus Metallothiol transferase fosB (fosB)
MBS1337289-03 0.02 mg (Yeast)

Recombinant Staphylococcus saprophyticus subsp. saprophyticus Metallothiol transferase fosB (fosB)

Sign In for Pricing
View Details
Recombinant Staphylococcus saprophyticus subsp. saprophyticus Metallothiol transferase fosB (fosB)
MBS1337289-04 0.1 mg (Yeast)

Recombinant Staphylococcus saprophyticus subsp. saprophyticus Metallothiol transferase fosB (fosB)

Sign In for Pricing
View Details
Recombinant Staphylococcus saprophyticus subsp. saprophyticus Metallothiol transferase fosB (fosB)
MBS1337289-05 0.02 mg (Baculovirus)

Recombinant Staphylococcus saprophyticus subsp. saprophyticus Metallothiol transferase fosB (fosB)

Sign In for Pricing
View Details