What is the catalog number for Jarid2 Antibody - middle region?

The catalog number for Jarid2 Antibody - middle region is ARP37307_P050-25UL.

What sizes are available for Jarid2 Antibody - middle region?

Jarid2 Antibody - middle region is available in the following size(s): 25 µL.

Is Jarid2 Antibody - middle region in stock?

Jarid2 Antibody - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

Is there an additional fee for hazardous or dry ice shipping of this product?

Yes, if this product requires dry ice or is classed as hazardous for transport, the additional fee will be explicitly shown in your quotation before you confirm the order, so there are no surprise charges later.

How many freeze-thaw cycles can this product tolerate?

We recommend aliquoting the product upon receipt to avoid repeated freeze-thaw cycles, which can reduce activity and stability. This is your responsibility once the product has been delivered.

Is antigen retrieval required for IHC with this antibody?

Recommended antigen retrieval methods, where applicable, are listed on the datasheet under the IHC protocol section.

Jarid2 Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

Jumonji, AT rich interactive domain 2

Gene Aliases

Jmj, jumo, jumonji

Gene ID

16468

Swiss Prot

Q62315

Accession Number

NP_068678

Reactivity

Human, Mouse, Rat, Dog, Guinea Pig, Rabbit

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of mouse Jarid2

Target

Jarid2 is a regulator of histone methyltransferase complexes that plays an essential role in embryonic development, including heart and liver development, neural tube fusion process and hematopoiesis.Jarid2 acts by modulating histone methyltransferase activity and promoting the recruitment of histone methyltransferase complexes to their target genes.Jarid2 binds DNA and mediates the recruitment of the PRC2 complex to target genes in embryonic stem cells.Jarid2 does not have histone demethylase activity but regulates activity of various histone methyltransferase complexes. In embryonic stem cells, it associates with the PRC2 complex and inhibits trimethylation of 'Lys-27' of histone H3 (H3K27me3) by the PRC2 complex, thereby playing a key role in differentiation of embryonic stem cells and normal development. In cardiac cells, it is required to repress expression of cyclin-D1 (CCND1) by activating methylation of 'Lys-9' of histone H3 (H3K9me) by the GLP1/EHMT1 and G9a/EHMT2 histone methyltransferases.Jarid2 also acts as a transcriptional repressor of ANF via its interaction with GATA4 and NKX2-5.Jarid2 participates in the negative regulation of cell proliferation signaling.

Partner Proteins

Rb1; Suz12; Ewsr1; Ell; Eed; Aebp2; Morc3; Setx; Stk38l; Thrap3; Ice1; Stk38; Bclaf1; Trim35; Rbbp4; Mtf2; Ezh2; Ezh1

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

NASSSCQSTPRKGKTHKHVHNGHVFNGSSRSAREKEPAHKHRSKEATPGK

Applications

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol