What is the catalog number for NRIP2 Antibody - N-terminal region?

The catalog number for NRIP2 Antibody - N-terminal region is ARP37306_P050-25UL.

What sizes are available for NRIP2 Antibody - N-terminal region?

NRIP2 Antibody - N-terminal region is available in the following size(s): 25 µL.

Is NRIP2 Antibody - N-terminal region in stock?

NRIP2 Antibody - N-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

What is the isotype of this antibody?

Isotype information such as IgG1 or IgG2a is listed in the product specifications on the datasheet, relevant for selecting compatible detection reagents.

Can I get a trial-size or discounted first order of this product?

We don’t generally offer free samples, but trial discounts in exchange for feedback and validation results are almost always possible. Contact us with your intended application to arrange one.

Do you offer bulk or custom quantities of this product?

Yes. Ordering two or more units, or combining this with other products, usually qualifies for a discount depending on quantity. Contact our sales team with your required volume for a custom quote.

NRIP2 Antibody - N-terminal region

Product Specifications

CAS Number

9007-83-4

Gene Name

Nuclear receptor interacting protein 2

Gene Aliases

NI, NIX1, AW491344

Gene ID

60345

Swiss Prot

Q14BZ2

Accession Number

NP_068363

Reactivity

Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Zebrafish

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse NRIP2

Target

NIX1 holds two copies of the LXXLL motif. NIX1 displays a neuronal specific expression pattern. It selectively interacts with distinct nuclear receptors of the RAR and TR subfamily, but does not bind steroid hormone receptors. By docking to activated nuclear receptors in an AF2-D-dependent fashion, NIX1 might displace coactivators and result in suppression of the transcriptional activity of liganded nuclear receptors.

Partner Proteins

Rorb; Thrb; Rara

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

HLSQQRQLKQATQFLHKDSADLLPLDSLKRLGTSKDLQPHSVIQRRLVEG

Applications

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol