What is the catalog number for Taf1b Antibody - middle region?

The catalog number for Taf1b Antibody - middle region is ARP37290_P050-25UL.

What sizes are available for Taf1b Antibody - middle region?

Taf1b Antibody - middle region is available in the following size(s): 25 µL.

Is Taf1b Antibody - middle region in stock?

Taf1b Antibody - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

How many freeze-thaw cycles can this product tolerate?

We recommend aliquoting the product upon receipt to avoid repeated freeze-thaw cycles, which can reduce activity and stability. This is your responsibility once the product has been delivered.

Is antigen retrieval required for IHC with this antibody?

Recommended antigen retrieval methods, where applicable, are listed on the datasheet under the IHC protocol section.

What temperature does this product ship at?

Shipping temperature is chosen based on the product’s stability needs, ranging from ambient to dry ice, and is indicated on the product page. Any related shipping fee is shown clearly in your quotation.

Taf1b Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

TATA box binding protein (Tbp) -associated factor, RNA polymerase I, B

Gene Aliases

P6, p63, mTAFI, TAFI68, Tafi86, 4930408G01Rik, A230108M10Rik

Gene ID

21340

Swiss Prot

P97358

Accession Number

NP_065639

Reactivity

Mouse, Rat

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of mouse Taf1b

Target

Component of the transcription factor SL1/TIF-IB complex, which is involved in the assembly of the PIC (preinitiation complex) during RNA polymerase I-dependent transcription. The rate of PIC formation probably is primarily dependent on the rate of association of SL1/TIF-IB with the rDNA promoter. SL1/TIF-IB is involved in stabilization of nucleolar transcription factor 1/UBTF on rDNA. Formation of SL1/TIF-IB excludes the association of TBP with TFIID subunits.

Partner Proteins

COPS2; Tbp; Taf1c; Taf1a; Rrn3; Tcf3

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

KYDVQAMAVIVVVLKLLFLLDDKLEWSYSDLAEAYNEQHREDTPQFDFRK

Applications

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol