What is the catalog number for TAF1B Antibody - C-terminal region?

The catalog number for TAF1B Antibody - C-terminal region is ARP37289_T100-25UL.

What sizes are available for TAF1B Antibody - C-terminal region?

TAF1B Antibody - C-terminal region is available in the following size(s): 25 µL.

Is TAF1B Antibody - C-terminal region in stock?

TAF1B Antibody - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

Can I get a trial-size or discounted first order of this product?

We don’t generally offer free samples, but trial discounts in exchange for feedback and validation results are almost always possible. Contact us with your intended application to arrange one.

Do you offer bulk or custom quantities of this product?

Yes. Ordering two or more units, or combining this with other products, usually qualifies for a discount depending on quantity. Contact our sales team with your required volume for a custom quote.

Do you provide a Certificate of Analysis (CoA) for this product?

A Certificate of Analysis is available for most products upon request. Contact our support team with the lot number to obtain the relevant CoA.

TAF1B Antibody - C-terminal region

Product Specifications

CAS Number

9007-83-4

Gene Name

TATA box binding protein (Tbp) -associated factor, RNA polymerase I, B

Gene Aliases

P6, p63, mTAFI, TAFI68, Tafi86, 4930408G01Rik, A230108M10Rik

Gene ID

21340

Swiss Prot

P97358

Accession Number

NP_065639

Reactivity

Mouse, Rat, Guinea Pig

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of mouse TAF1B

Target

TAF1b belongs to the family of TATA box binding protein (Tbp) -associated factors. Promoter selectivity for all three classes of eukaryotic RNA polymerases is brought about by multimeric protein complexes containing TATA box binding protein (TBP) and specific TBP-associated factors (TAFs) .

Partner Proteins

COPS2; Tbp; Taf1c; Taf1a; Rrn3; Tcf3

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

YQFILNIFSFLLRIKTSALHEEVSLLEKKLFEKKYNESKKSSGSKKGRRH

Applications

Purification

Protein A purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol