What is the catalog number for CITED4 Antibody - N-terminal region?

The catalog number for CITED4 Antibody - N-terminal region is ARP37255_T100-25UL.

What sizes are available for CITED4 Antibody - N-terminal region?

CITED4 Antibody - N-terminal region is available in the following size(s): 25 µL.

Is CITED4 Antibody - N-terminal region in stock?

CITED4 Antibody - N-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

What is the purity of this recombinant protein?

Purity, typically assessed by SDS-PAGE, is listed on the datasheet under quality control data.

What do I do if this product arrives with reduced ice or a damaged cold-chain package?

Report this to us immediately with photos and your order reference. Our specialists will assess whether the product is still usable given the cold-chain interruption, and will arrange a replacement or credit if it isn’t.

What host species was used to raise this antibody?

The host species used in production is listed under product specifications on the datasheet, and is relevant when selecting a compatible secondary antibody for your assay.

CITED4 Antibody - N-terminal region

Product Specifications

CAS Number

9007-83-4

Gene Name

Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 4

Gene Aliases

Mrg, Mrg2, MRG-2

Gene ID

56222

Swiss Prot

Q9WUL8

Accession Number

NP_062509

Reactivity

Mouse, Rat

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse CITED4

Target

Cited4 is a member of The CITED family proteins that bind to CBP/p300 transcriptional integrators through their conserved C-terminal acidic domain and function as coactivators. It also interacts with isoforms of the TFAP2 transcription factor, coactivating TFAP2-dependent transcription.

Partner Proteins

Crebbp; Rbm39; Ivns1abp; Tle6; Sirt1; Cers2; Rai14; Polr3f; Zdhhc6; Ankrd22; Phtf1; Hivep2; Ezh2; Ciita; Hnrnpd

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

PYAGPGMDSGLRPRGAPLGPPPPPGTLAYGSFGSPVSFQPFPVSQSPGAG

Applications

Purification

Protein A purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol