What is the catalog number for Atp6v0a1 Antibody - C-terminal region?

The catalog number for Atp6v0a1 Antibody - C-terminal region is ARP37232_P050-25UL.

What sizes are available for Atp6v0a1 Antibody - C-terminal region?

Atp6v0a1 Antibody - C-terminal region is available in the following size(s): 25 µL.

Is Atp6v0a1 Antibody - C-terminal region in stock?

Atp6v0a1 Antibody - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

What buffer is this product supplied in?

The formulation or storage buffer is listed on the product datasheet. If you require a carrier-free or custom formulation, contact us before ordering, as this may involve a made-to-order production timeline.

What dilution range is recommended for immunohistochemistry (IHC) with this antibody?

A starting IHC dilution range is listed on the datasheet, but should be optimized for your specific tissue type and staining protocol.

Can I request a Safety Data Sheet (SDS) for this product?

Yes, safety data sheets are available for hazardous or chemically classified products and can be provided on request or downloaded from the product page.

Atp6v0a1 Antibody - C-terminal region

Product Specifications

CAS Number

9007-83-4

Gene Name

ATPase, H+ transporting, lysosomal V0 subunit A1

Gene Aliases

V, Vp, Atp, Vpp1, Vpp-1, ATP6a1, Atp6n1, Atp6n1a, Atpv0a1, AA959968, ARP37232

Gene ID

11975

Swiss Prot

A2A5A0

Accession Number

NP_058616

Reactivity

Human, Mouse, Rat, Cow, Horse, Pig, Rabbit

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Target

Atp6v0a1 is required for assembly and activity of the vacuolar ATPase. Atp6v0a1 has a potential role in differential targeting and regulation of the enzyme for a specific organelle.

Partner Proteins

Eed; Atp6v1g1; Atp6v1g2; SNCA

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

TLNFGGIRVGNGPTEEDAEIIQHDQLSTHSEDAEEPTEDEVFDFGDTMVH

Applications

IHC, WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol