What is the catalog number for Rorc Antibody - N-terminal region?

The catalog number for Rorc Antibody - N-terminal region is ARP37127_P050-25UL.

What sizes are available for Rorc Antibody - N-terminal region?

Rorc Antibody - N-terminal region is available in the following size(s): 25 µL.

Is Rorc Antibody - N-terminal region in stock?

Rorc Antibody - N-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

What is the recommended positive control for this assay?

A recommended positive control, where one is specified by the manufacturer, is listed on the datasheet or in the assay protocol.

How should this product be stored?

Storage conditions depend on the specific reagent and are listed on the product datasheet, with most antibodies and proteins requiring -20°C unless stated otherwise. It is your responsibility to store the product correctly immediately upon receipt; damage from improper storage after delivery is not eligible for replacement.

Is this product animal-origin-free?

Animal-origin-free status, where applicable, is noted on the datasheet under formulation details.

Rorc Antibody - N-terminal region

Product Specifications

CAS Number

9007-83-4

Gene Name

RAR-related orphan receptor gamma

Gene Aliases

Th, ROR, TOR, Thor, Nr1f3, RORgamma

Gene ID

19885

Swiss Prot

P51450

Accession Number

NP_035411

Reactivity

Human, Mouse, Rat, Dog, Guinea Pig

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Target

Rorc is an orphan nuclear receptor. Isoform 2 negatively regulates expression of TNFSF6/FASL and IL2 production in T-cells. It also binds to the TEA promoter and may participate in the regulation of DNA accessibility in the TCR-Jalpha locus.

Partner Proteins

Cul3; Chd4; Ewsr1

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

VKFGRMSKKQRDSLHAEVQKQLQQQQQQEQVAKTPPAGSRGADTLTYTLG

Applications

WB, IHC

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol