Foxa2 Antibody - C-terminal region

Product Specifications

CAS Number

9007-83-4

Gene Name

Forkhead box A2

Gene Aliases

Hnf3, Hnf-3, Hnf3b, Tcf3b, HNF3be, Hnf-3b, Tcf-3b, HNF3-be, HNF3beta, HNF3-beta

Gene ID

15376

Swiss Prot

P35583

Accession Number

NP_034576

Reactivity

Mouse, Rat

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Target

Foxa2 is a transcription factor that is involved in embryonic development, establishment of tissue-specific gene expression and regulation of gene expression in differentiated tissues. Foxa2 is thought to act as a 'pioneer' factor opening the compacted chromatin for other proteins through interactions with nucleosomal core histones and thereby replacing linker histones at target enhancer and/or promoter sites. In embryonic development Foxa2 is required for notochord formation. Foxa2 is involved in the development of multiple endoderm-derived organ systems such as the liver, pancreas and lungs; Foxa1 and Foxa2 seem to have at least in part redundant roles. Foxa2 modulates the transcriptional activity of nuclear hormone receptors; inhibits AR-mediated transcription from the LCN5 promoter. Foxa2 binds to fibrinogen beta promoter and is involved in IL6-induced fibrinogen beta transcriptional activation. Foxa2 interacts with the cis-acting regulatory regions of these genes. Foxa2 is involved in glucose homeostasis; regulates the expression of genes important for glucose sensing in pancreatic beta-cells and glucose homeostasis. Foxa2 is involved in regulation of fat metabolism; activates transcriptional programs of lipid metabolism and ketogenesis at low insulin state.

Partner Proteins

Ucp2; Gck; Pklr; Hnf4a; Igfbp1; Acadm; Acadvl

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

VDVEGTDYLNGDLGWSSSVSDSDERGSMQSLGSDEGYSSATVKRAKLQDG

Applications

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol