What is the catalog number for SMYD1 Antibody - N-terminal region?

The catalog number for SMYD1 Antibody - N-terminal region is ARP37022_P050-25UL.

What sizes are available for SMYD1 Antibody - N-terminal region?

SMYD1 Antibody - N-terminal region is available in the following size(s): 25 µL.

Is SMYD1 Antibody - N-terminal region in stock?

SMYD1 Antibody - N-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

What is the difference between this product and a similar catalogue number?

Differences typically involve clone, conjugate, host species, or validated applications. Compare the respective datasheets, or contact us with both catalogue numbers for a direct comparison.

Do you offer custom or private-label production of this type of product?

Yes, custom antibody development and private-label production services are available. Contact our sales team to discuss your target, timeline, and quantity requirements.

What is the immunogen used to generate this antibody?

Immunogen or antigen details used to raise this antibody are listed on the product datasheet under immunogen information.

SMYD1 Antibody - N-terminal region

Product Specifications

CAS Number

9007-83-4

Gene Name

SET and MYND domain containing 1

Gene Aliases

B, Bop, C78565, Zmynd18, 4632404M21Rik

Gene ID

12180

Swiss Prot

P97443-2

Accession Number

NP_033892

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse SMYD1

Target

SMYD1 is a histone methyltransferases and plays a critical role in myofibril organization during myofiber maturation

Partner Proteins

Trp53; Naca; Hdac1; Hdac3; Hdac2

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

MENVEVFTSEGKGRGLKATKEFWAADVIFAERAYSAVVFDSLINFVCHTC

Applications

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol