What is the catalog number for APEX1 antibody - N-terminal region (ARP37014_T100)?

The catalog number for APEX1 antibody - N-terminal region (ARP37014_T100) is ARP37014_T100.

What sizes are available for APEX1 antibody - N-terminal region (ARP37014_T100)?

APEX1 antibody - N-terminal region (ARP37014_T100) is available in the following size(s): 100 µL.

Is APEX1 antibody - N-terminal region (ARP37014_T100) in stock?

APEX1 antibody - N-terminal region (ARP37014_T100) is currently made to order / not held in immediate stock. Contact us for lead time.

What documentation should I request if this product is used for a regulated or intellectual-property-sensitive application?

If the product is subject to intellectual property protections, we’ll advise on any MTA or usage restrictions before shipping. Let us know your intended end use so we can confirm what’s required upfront.

Is this antibody conjugated?

Conjugation status, such as unconjugated, HRP, FITC, or biotin, is specified in the product name and confirmed on the datasheet.

What is the sensitivity of this ELISA kit?

Assay sensitivity, including the minimum detectable dose, is listed on the datasheet. Kits that are assembled on order typically ship within 2-4 weeks.

APEX1 antibody - N-terminal region (ARP37014_T100)

Product Specifications

CAS Number

9007-83-4

Gene Name

Apurinic/apyrimidinic endonuclease 1

Gene Aliases

HA, APE, Apex, HAP1, Ref-, Ref-1

Gene ID

11792

Swiss Prot

Q544Z7

Accession Number

NP_033817

Reactivity

Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse APEX1

Target

Apurinic/apyrimidinic (AP) sites occur frequently in DNA molecules by spontaneous hydrolysis, by DNA damaging agents or by DNA glycosylases that remove specific abnormal bases. AP sites are pre-mutagenic lesions that can prevent normal DNA replication so the cell contains systems to identify and repair such sites. Class II AP endonucleases cleave the phosphodiester backbone 5' to the AP site. This gene encodes the major AP endonuclease in human cells.

Partner Proteins

Pcna; Gadd45a; Eed; Mutyh; Plcb1; Hdac1; Sin3a; Hdac2

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

ETKKSKGAAKKTEKEAAGEGPVLYEDPPDQKTSPSGKSATLKICSWNVDG

Applications

Purification

Protein A purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

1.0 mg/ml

Homology

Cow: 100%; Dog: 93%; Goat: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 93%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

35kDa

Protein Length

317

NCBI Gene Symbol

APEX1

Host or Source

Rabbit

Protein Name

Apurinic/apyrimidinic endonuclease 1 EMBL EDL20835.1

Gene Name URL