What is the catalog number for Npas2 Antibody - middle region?

The catalog number for Npas2 Antibody - middle region is ARP36954_P050-25UL.

What sizes are available for Npas2 Antibody - middle region?

Npas2 Antibody - middle region is available in the following size(s): 25 µL.

Is Npas2 Antibody - middle region in stock?

Npas2 Antibody - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

Is antigen retrieval required for IHC with this antibody?

Recommended antigen retrieval methods, where applicable, are listed on the datasheet under the IHC protocol section.

What temperature does this product ship at?

Shipping temperature is chosen based on the product’s stability needs, ranging from ambient to dry ice, and is indicated on the product page. Any related shipping fee is shown clearly in your quotation.

What is the molecular weight of the target protein?

Molecular weight information, where applicable, is listed on the datasheet under target details, useful for confirming the correct band on western blot.

Npas2 Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

Neuronal PAS domain protein 2

Gene Aliases

MO, MOP4, bHLHe, bHLHe9

Gene ID

18143

Swiss Prot

P97460

Accession Number

NP_032745

Reactivity

Mouse, Rat, Cow, Pig

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Target

BMAL1-NPAS2 heterodimers activate E-box element (3'-CACGTG-5') transcription of a number of proteins of the circadian clock. This transcription is inhibited in a feedback loop by PER, and also by CRY proteins.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

VSYADVRVERRQELALEDPPTEAMHPSAVKEKDSSLEPPQPFNALDMGAS

Applications

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol